From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01025 [old locus tag: SA0170 ]
  • pan locus tag?: SAUPAN001014000
  • symbol: SA_RS01025
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01025 [old locus tag: SA0170 ]
  • symbol: SA_RS01025
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 193553..193912
  • length: 360
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (193553..193912) NCBI
  • BioCyc: SA_RS01025 BioCyc
  • MicrobesOnline: see SA0170

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    GTGAATACTATAGATACGCATACTAAAGAACAACAATTCTCGAATCTAGTAAGATCTTAT
    CGTAAAGAATACGTGGGTAAAGGACCCAATAGTATTCGAGTGTCGTTTAAAGATAATTGG
    GCGATTGCACATATGACAGGTGTTTTGAGTAAAGTTGAGAGTTTTTACCTAAACGACAAA
    CGCAATGAATCAATGCTCCATTATACACGCACAGAGAAGATTAAACAGATGTATAAAGAA
    ATAGATGTAAATGAGATGGAAAGTCTTGTAGGCGCTAAGTTTGTAAAATTATTTACAGAT
    ATTGATTTGAATGATGATGAAGTCATTTCAATATTTGTTTTCGATAAGTCAATAGAATAA
    60
    120
    180
    240
    300
    360


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01025 [old locus tag: SA0170 ]
  • symbol: SA_RS01025
  • description: hypothetical protein
  • length: 119
  • theoretical pI: 6.26459
  • theoretical MW: 13979.8
  • GRAVY: -0.536134

Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical protein (TIGR01741; HMM-score: 15.5)
  • TheSEED: see SA0170
  • PFAM:
    no clan defined MpsC; Na+-translocating membrane potential-generating system (MpsC) (PF10057; HMM-score: 103)
    and 2 more
    DUF3269; Protein of unknown function (DUF3269) (PF11673; HMM-score: 14.1)
    APO_RNA-bind; APO RNA-binding (PF05634; HMM-score: 13.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8819
    • Cytoplasmic Membrane Score: 0.06
    • Cell wall & surface Score: 0.0008
    • Extracellular Score: 0.0572
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00786
    • TAT(Tat/SPI): 0.000484
    • LIPO(Sec/SPII): 0.001576
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNTIDTHTKEQQFSNLVRSYRKEYVGKGPNSIRVSFKDNWAIAHMTGVLSKVESFYLNDKRNESMLHYTRTEKIKQMYKEIDVNEMESLVGAKFVKLFTDIDLNDDEVISIFVFDKSIE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • data available for JSNZ

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]