From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS01150 [old locus tag: SA0194 ]
  • pan locus tag?: SAUPAN001049000
  • symbol: SA_RS01150
  • pan gene symbol?:
  • synonym:
  • product: membrane protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS01150 [old locus tag: SA0194 ]
  • symbol: SA_RS01150
  • product: membrane protein
  • replicon: chromosome
  • strand: +
  • coordinates: 229259..229480
  • length: 222
  • essential: no DEG

Accession numbers[edit | edit source]

  • Location: NC_002745 (229259..229480) NCBI
  • BioCyc: SA_RS01150 BioCyc
  • MicrobesOnline: see SA0194

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCTAAAATTACATAAAAAAATAGCTTGGACAGGAATCAAAGGTTCAGCTATAACTACA
    TTTATTACTGCCTTATATAATGGAAGTAGTGTTTGGAACGCGCTAGCTGTTGCTGGTATT
    GCTTTTGGTGGTGGCGCTGGTACTGCGGTTGCAGCTCTTGGTCGTGCAACAGTAATGAGA
    TTTATCAAACGTTGGGGCGTACGAAAAACAGCTGCTTGGTAA
    60
    120
    180
    222

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS01150 [old locus tag: SA0194 ]
  • symbol: SA_RS01150
  • description: membrane protein
  • length: 73
  • theoretical pI: 12.5474
  • theoretical MW: 7664.05
  • GRAVY: 0.50137

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance circular bacteriocin, circularin A/uberolysin family (TIGR03651; HMM-score: 17.3)
  • TheSEED: see SA0194
  • PFAM:
    no clan defined CclA_1; Putative cyclic bacteriocin (PF16942; HMM-score: 44.1)
    and 1 more
    Bacteriocin_IId; Bacteriocin class IId cyclical uberolysin-like (PF09221; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0105
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.9895
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.178644
    • TAT(Tat/SPI): 0.041857
    • LIPO(Sec/SPII): 0.020738
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MLKLHKKIAWTGIKGSAITTFITALYNGSSVWNALAVAGIAFGGGAGTAVAALGRATVMRFIKRWGVRKTAAW

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]