From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03855 [old locus tag: SA0677 ]
  • pan locus tag?: SAUPAN002609000
  • symbol: SA_RS03855
  • pan gene symbol?: opuBA
  • synonym:
  • product: glycine/betaine ABC transporter ATP-binding protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS03855 [old locus tag: SA0677 ]
  • symbol: SA_RS03855
  • product: glycine/betaine ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 772348..773325
  • length: 978
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (772348..773325) NCBI
  • BioCyc: SA_RS03855 BioCyc
  • MicrobesOnline: see SA0677

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    GTGATTAAGTTTAAAAATGTAACTAAGCGTTATGGCAAACATGTTGCTGTCGATAACATT
    AGTTTCAATATTAATGAGGGTGAATTTTTTGTGCTAATTGGACCTTCAGGTTGTGGAAAA
    ACTACGACATTAAAAATGATTAATCGACTCATTCACTTAAGTGAAGGTTATATTTATTTT
    AAAGATAAACCAATAAGTGATTATCCAGTATACGAAATGCGTTGGGATATTGGATACGTA
    TTGCAGCAGATTGCATTATTCCCACATATGACGATCAAAGAAAATATTGCACAAGTGCCA
    CAAATGAAAAAGTGGAAAGAAAAAGATATAGATAAAAGAGTAGATGAATTACTTGATATG
    GTTGGATTAGAACCTGAAAAATATAAAAACAGAAAACCTGATGAATTGTCAGGGGGGCAA
    CGACAACGTGTAGGAGTTATACGTGCGTTAGCAGCTGATCCACCAGTTATTTTAATGGAT
    GAACCGTTTAGTGCATTAGACCCAATCAGCCGAGAAAAACTTCAAGATGATTTAATTGAA
    TTACAAACTAAAATTAAGAAGACAATCATATTTGTTACACATGATATTCAAGAGGCGATG
    AAACTTGGTGATAAGATTTGTCTTTTGAATGAAGGGCATATTGAACAAATTGACACACCA
    GAAGGATTTAAAAATAATCCTCAAAGTGAATTTGTTAAACAATTTATGGGTAGTCATTTA
    GAAGATGATGCGCCATGTGTTGAAGAGAACGCAATTATTCGTGACTTGGATATTATGAAA
    CCAATCGATGAGGTTACATCTATGAGCGCTTATCCAATTGTTTATGACAATCAACCAATT
    GAAGTATTGTATCAACATTTATCAGAGAGCGAGCGTGTCATTGTCATGCAAGAAGATAGC
    GTAGGTCAATATGTTATTGATAGGAAAGATATCTTCAAATATTTGTCCCAGAAAAAGGAG
    GTAGCTCAACATGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    978

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS03855 [old locus tag: SA0677 ]
  • symbol: SA_RS03855
  • description: glycine/betaine ABC transporter ATP-binding protein
  • length: 325
  • theoretical pI: 5.07688
  • theoretical MW: 37548
  • GRAVY: -0.427077

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 305.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 244.9)
    and 73 more
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 240)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 231.7)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 222.6)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 187)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 180.6)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 167.9)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 164.7)
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 164.1)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 162.2)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 161.9)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 156.4)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 156.4)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 154.3)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 154.3)
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 153.6)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 147)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 147)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 144.3)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 138.4)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 138.2)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 137)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 136.5)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 135.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 135.2)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 130.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 130.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 129)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 129)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 128.7)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 123.8)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 122.5)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 122.3)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 119.1)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 119.1)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 115.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 113.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 112.3)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 112.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 107.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 103.6)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 102.5)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 100.4)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 99.2)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 97.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 97.8)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 96.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 96.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 93.9)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 93.9)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 93.9)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 93.4)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 89.8)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 89.7)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.1)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 89.1)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 87.2)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 84.9)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 81.1)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 71)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 66.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 59.1)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 59.1)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 58.8)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 58)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 55)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 49.7)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 37.7)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 33.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 27.7)
    Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 18.5)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 14.9)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair putative DNA helicase (TIGR00376; EC 3.6.4.12; HMM-score: 13.8)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA replication and repair protein RecF (TIGR00611; HMM-score: 12.4)
  • TheSEED: see SA0677
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 121.2)
    and 27 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 47.1)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 21.7)
    AAA_22; AAA domain (PF13401; HMM-score: 20.9)
    nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 18.6)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 18.2)
    Rad17; Rad17 P-loop domain (PF03215; HMM-score: 17.9)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 16.8)
    AAA_19; AAA domain (PF13245; HMM-score: 15.5)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 15.4)
    AAA_28; AAA domain (PF13521; HMM-score: 15.1)
    AAA_30; AAA domain (PF13604; HMM-score: 15)
    AAA_24; AAA domain (PF13479; HMM-score: 14.7)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 14.4)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 14.1)
    ORC-CDC6-like; ORC-CDC6-like (PF24389; HMM-score: 14.1)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.5)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 13.5)
    AAA_14; AAA domain (PF13173; HMM-score: 13.5)
    AAA_11; AAA domain (PF13086; HMM-score: 13.1)
    AAA_23; AAA domain (PF13476; HMM-score: 13.1)
    AAA_18; AAA domain (PF13238; HMM-score: 12.7)
    RING (CL0229) U-box; U-box domain (PF04564; HMM-score: 12.6)
    P-loop_NTPase (CL0023) AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.3)
    AAA_25; AAA domain (PF13481; HMM-score: 12.2)
    ABC_ATPase; P-loop domain (PF09818; HMM-score: 12.1)
    AAA_27; AAA domain (PF13514; HMM-score: 11.9)
    T2SSE; Type II/IV secretion system protein (PF00437; HMM-score: 11)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0791
    • Cytoplasmic Membrane Score: 0.9119
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.0086
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.021324
    • TAT(Tat/SPI): 0.000538
    • LIPO(Sec/SPII): 0.016684
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MIKFKNVTKRYGKHVAVDNISFNINEGEFFVLIGPSGCGKTTTLKMINRLIHLSEGYIYFKDKPISDYPVYEMRWDIGYVLQQIALFPHMTIKENIAQVPQMKKWKEKDIDKRVDELLDMVGLEPEKYKNRKPDELSGGQRQRVGVIRALAADPPVILMDEPFSALDPISREKLQDDLIELQTKIKKTIIFVTHDIQEAMKLGDKICLLNEGHIEQIDTPEGFKNNPQSEFVKQFMGSHLEDDAPCVEENAIIRDLDIMKPIDEVTSMSAYPIVYDNQPIEVLYQHLSESERVIVMQEDSVGQYVIDRKDIFKYLSQKKEVAQHD

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:
    SA_RS00690immunoglobulin G-binding protein A  [1] (data from MRSA252)

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]