From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS03965 [old locus tag: SA0696 ]
  • pan locus tag?: SAUPAN002647000
  • symbol: SA_RS03965
  • pan gene symbol?: brxC
  • synonym: ytxJ
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS03965 [old locus tag: SA0696 ]
  • symbol: SA_RS03965
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 794228..794548
  • length: 321
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (794228..794548) NCBI
  • BioCyc: SA_RS03965 BioCyc
  • MicrobesOnline: see SA0696

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    GTGGCTATAAAGCTAAGTTCAATTGACCAATTTGAACAGGTTATTGAGGAAAATAAATAT
    GTTTTTGTATTAAAACATAGTGAAACTTGTCCAATATCGGCAAATGCGTACGATCAATTT
    AATAAATTTTTATATGAACGCGATATGGACGGTTATTATTTGATTGTCCAACAAGAACGC
    GATTTGTCAGATTATATTGCTAAAAAAACGAACGTTAAACATGAATCACCTCAAGCATTT
    TATTTTGTAAATGGTGAAATGGTTTGGAATCGAGACCACGGTGATATCAATGTGTCGTCA
    TTAGCACAAGCAGAAGAATAA
    60
    120
    180
    240
    300
    321

Protein[edit | edit source]

Protein Data Bank: 3IV4

General[edit | edit source]

  • locus tag: SA_RS03965 [old locus tag: SA0696 ]
  • symbol: SA_RS03965
  • description: hypothetical protein
  • length: 106
  • theoretical pI: 4.44331
  • theoretical MW: 12436.8
  • GRAVY: -0.557547

Function[edit | edit source]

  • TIGRFAM:
    Unknown function Enzymes of unknown specificity bacillithiol system protein YtxJ (TIGR04019; HMM-score: 111.4)
  • TheSEED: see SA0696
  • PFAM:
    Thioredoxin (CL0172) BrxC; Monothiol bacilliredoxin BrxC (PF11009; HMM-score: 114.6)
    and 4 more
    no clan defined HHA; Haemolysin expression modulating protein (PF05321; HMM-score: 15.7)
    GBD (CL0202) CBM_11; Carbohydrate binding domain (family 11) (PF03425; HMM-score: 14.4)
    no clan defined HI_0552; HI_0552 protein family (PF10786; HMM-score: 14.4)
    DUF2977; Protein of unknown function (DUF2977) (PF11192; HMM-score: 14.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9543
    • Cytoplasmic Membrane Score: 0.0099
    • Cell wall & surface Score: 0.0026
    • Extracellular Score: 0.0332
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005812
    • TAT(Tat/SPI): 0.000316
    • LIPO(Sec/SPII): 0.000877
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQERDLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]