From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04270 [old locus tag: SAS018 ]
  • pan locus tag?: SAUPAN002806000
  • symbol: SA_RS04270
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04270 [old locus tag: SAS018 ]
  • symbol: SA_RS04270
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 858892..859080
  • length: 189
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (858892..859080) NCBI
  • BioCyc: SA_RS04270 BioCyc
  • MicrobesOnline: see SAS018

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACG
    TTTATACTCGTATTAATGAAAAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGT
    TTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAATATACACATTTATATTTGGT
    GTGCTATAA
    60
    120
    180
    189

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS04270 [old locus tag: SAS018 ]
  • symbol: SA_RS04270
  • description: hypothetical protein
  • length: 62
  • theoretical pI: 10.0084
  • theoretical MW: 7142.76
  • GRAVY: 1.46613

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAS018
  • PFAM:
    no clan defined BRI3BP; Negative regulator of p53/TP53 (PF14965; HMM-score: 16.7)
    MRAP; Melanocortin-2 receptor accessory protein family (PF15183; HMM-score: 16.2)
    GPCR_A (CL0192) Bac_rhodopsin; Bacteriorhodopsin-like protein (PF01036; HMM-score: 15)
    and 14 more
    no clan defined DUF3611; Protein of unknown function (DUF3611) (PF12263; HMM-score: 12.8)
    PGG; Domain of unknown function (PF13962; HMM-score: 12.4)
    Glucos_trans_II; Glucosyl transferase GtrII (PF14264; HMM-score: 11.5)
    SLC3A2_N; Solute carrier family 3 member 2 N-terminus (PF16028; HMM-score: 11.5)
    DUF3742; Protein of unknown function (DUF3742) (PF12553; HMM-score: 11.4)
    SIT; SHP2-interacting transmembrane adaptor protein, SIT (PF15330; HMM-score: 11.2)
    DUF3671; Protein of unknown function (PF12420; HMM-score: 10.3)
    DUF4051; Protein of unknown function (DUF4051) (PF13260; HMM-score: 9.9)
    NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 9.5)
    no clan defined CcmH; Cytochrome C biogenesis protein (PF03918; HMM-score: 9.2)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 9)
    no clan defined DUF2208; Predicted membrane protein (DUF2208) (PF09973; HMM-score: 8.4)
    DHHC; DHHC palmitoyltransferase (PF01529; HMM-score: 8.3)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 8.1)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008667
    • TAT(Tat/SPI): 0.00071
    • LIPO(Sec/SPII): 0.122172
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSLHFAILFWLALIFLVAATFILVLMKKTGKESKKESYLSFTVILYIFGFAILIYTFIFGVL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA_RS04270&oldid=94399"