From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS04540 [old locus tag: SA0795 ]
  • pan locus tag?: SAUPAN003033000
  • symbol: SA_RS04540
  • pan gene symbol?: dltC
  • synonym:
  • product: D-alanine--poly(phosphoribitol) ligase subunit 2

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS04540 [old locus tag: SA0795 ]
  • symbol: SA_RS04540
  • product: D-alanine--poly(phosphoribitol) ligase subunit 2
  • replicon: chromosome
  • strand: +
  • coordinates: 901134..901370
  • length: 237
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (901134..901370) NCBI
  • BioCyc: SA_RS04540 BioCyc
  • MicrobesOnline: see SA0795

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGAATTTAGAGAACAAGTATTAAATTTATTAGCAGAAGTAGCAGAAAATGATATTGTA
    AAAGAAAATCCAGACGTAGAAATTTTTGAAGAAGGTATTATTGATTCTTTCCAAACAGTT
    GGATTATTATTAGAGATTCAAAATAAACTTGATATCGAAGTATCTATTATGGACTTTGAT
    AGAGATGAGTGGGCAACACCAAATAAAATCGTTGAAGCATTAGAAGAGTTACGATGA
    60
    120
    180
    237


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS04540 [old locus tag: SA0795 ]
  • symbol: SA_RS04540
  • description: D-alanine--poly(phosphoribitol) ligase subunit 2
  • length: 78
  • theoretical pI: 3.67678
  • theoretical MW: 9063.14
  • GRAVY: -0.164103

⊟Function[edit | edit source]

  • reaction:
    EC 6.1.1.13?  ExPASy
    D-alanine--poly(phosphoribitol) ligase ATP + D-alanine + poly(ribitol phosphate) = AMP + diphosphate + O-D-alanyl-poly(ribitol phosphate)
  • TIGRFAM:
    Cell structure Cell envelope Biosynthesis and degradation of murein sacculus and peptidoglycan D-alanine--poly(phosphoribitol) ligase, subunit 2 (TIGR01688; EC 6.1.1.13; HMM-score: 136.3)
    and 1 more
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acyl carrier protein (TIGR00517; HMM-score: 13.5)
  • TheSEED: see SA0795
  • PFAM:
    PP-binding (CL0314) PP-binding; Phosphopantetheine attachment site (PF00550; HMM-score: 31.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9959
    • Cytoplasmic Membrane Score: 0.0017
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0024
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002447
    • TAT(Tat/SPI): 0.000177
    • LIPO(Sec/SPII): 0.000198
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEFREQVLNLLAEVAENDIVKENPDVEIFEEGIIDSFQTVGLLLEIQNKLDIEVSIMDFDRDEWATPNKIVEALEELR

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]