Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS05210 [old locus tag: SA0919 ]
- pan locus tag?: SAUPAN003280000
- symbol: SA_RS05210
- pan gene symbol?: purS
- synonym:
- product: phosphoribosylformylglycinamidine synthase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS05210 [old locus tag: SA0919 ]
- symbol: SA_RS05210
- product: phosphoribosylformylglycinamidine synthase
- replicon: chromosome
- strand: +
- coordinates: 1043905..1044168
- length: 264
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAACAATTGAACTACATATCACATTACAACCACAAGTATTAGATACGCAAGGACAA
ACGCTTACTCGAGCTGTACATGACTTAGGTTATGCACAAGTGAATGATATTCGTGTAGGA
AAAGTATTATATATGACAGTGGATGAGGTTAGTGATGAAAAGGTACACAACATTATTACA
ACTCTAAGTGAAAAATTGTTTGCAAATACAGTGATTGAAGAATATAGCTATAAAGTGTTA
GATGATGAAAAGGAGAATGCATAA60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS05210 [old locus tag: SA0919 ]
- symbol: SA_RS05210
- description: phosphoribosylformylglycinamidine synthase
- length: 87
- theoretical pI: 4.46527
- theoretical MW: 9921.15
- GRAVY: -0.295402
⊟Function[edit | edit source]
- reaction: EC 6.3.5.3? ExPASyPhosphoribosylformylglycinamidine synthase ATP + N2-formyl-N1-(5-phospho-D-ribosyl)glycinamide + L-glutamine + H2O = ADP + phosphate + 2-(formamido)-N1-(5-phospho-D-ribosyl)acetamidine + L-glutamate
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis phosphoribosylformylglycinamidine synthase, purS protein (TIGR00302; HMM-score: 73.1)
- TheSEED: see SA0919
- PFAM: no clan defined PurS; Phosphoribosylformylglycinamidine (FGAM) synthase (PF02700; HMM-score: 81.1)and 2 moreT3RM_EcoP15I_C; Type III R-M EcoP15I C-terminal domain (PF18273; HMM-score: 14.9)DUF3333; Domain of unknown function (DUF3333) (PF11812; HMM-score: 14.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9981
- Cytoplasmic Membrane Score: 0.0005
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0013
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006483
- TAT(Tat/SPI): 0.000384
- LIPO(Sec/SPII): 0.000822
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKTIELHITLQPQVLDTQGQTLTRAVHDLGYAQVNDIRVGKVLYMTVDEVSDEKVHNIITTLSEKLFANTVIEEYSYKVLDDEKENA
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: PurR see SA0919
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]