From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS06515 [old locus tag: SA1152 ]
  • pan locus tag?: SAUPAN003635000
  • symbol: SA_RS06515
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS06515 [old locus tag: SA1152 ]
  • symbol: SA_RS06515
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1311840..1312025
  • length: 186
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (1311840..1312025) NCBI
  • BioCyc: SA_RS06515 BioCyc
  • MicrobesOnline: see SA1152

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGTCAGAATACAAGAAAAAGATAATTGAATTAATTGAAAGTAATTTAACAGGATATGAA
    ATTTCTAAAAAAACTGGAGTTTCTCAATATGTACTTTCACAATTAAGACAGGGCAAACGC
    GAAGTAGATAATCTAACCCTGAATACAACAGAAAAATTATATGAATATGCCAATAAAGTT
    TTGTAA
    60
    120
    180
    186


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS06515 [old locus tag: SA1152 ]
  • symbol: SA_RS06515
  • description: hypothetical protein
  • length: 61
  • theoretical pI: 9.39889
  • theoretical MW: 7100.1
  • GRAVY: -0.639344

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA1152
  • PFAM:
    HTH (CL0123) HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 16.6)
    HTH_3; Helix-turn-helix (PF01381; HMM-score: 15.1)
    HTH_11; HTH domain (PF08279; HMM-score: 14.2)
    and 2 more
    no clan defined Endotoxin_N; delta endotoxin, N-terminal domain (PF03945; HMM-score: 12.9)
    HTH (CL0123) Dimerisation2-like_dom; Dimerisation2-like domain (PF21212; HMM-score: 12.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8773
    • Cytoplasmic Membrane Score: 0.0007
    • Cell wall & surface Score: 0.0007
    • Extracellular Score: 0.1214
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011002
    • TAT(Tat/SPI): 0.000421
    • LIPO(Sec/SPII): 0.001575
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MSEYKKKIIELIESNLTGYEISKKTGVSQYVLSQLRQGKREVDNLTLNTTEKLYEYANKVL

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]