From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS06960 [old locus tag: SA1225 ]
  • pan locus tag?: SAUPAN003806000
  • symbol: SA_RS06960
  • pan gene symbol?: lysC
  • synonym:
  • product: aspartate kinase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS06960 [old locus tag: SA1225 ]
  • symbol: SA_RS06960
  • product: aspartate kinase
  • replicon: chromosome
  • strand: +
  • coordinates: 1399743..1400948
  • length: 1206
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (1399743..1400948) NCBI
  • BioCyc: G1G21-1405 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    ATGGTAACAAGAAGTGTGTTGAAATTTGGCGGATCATCCGTCAGTGATTTTACAAAAATA
    AAAAGGATCGCTGAAATGTTAAAGGAGCGAGTCAATCAAGATGAACAATTAATTGTCGTT
    GTAAGTGCTATGGGTAACACAACAGATCAATTAATGACGAATGTATCGACCTTGACTAAA
    GCACCAAAACAACAAGAACTGGCATTATTATTGACAACCGGAGAGCAACAAACTGTATCT
    TATTTATCAATGGTATTAAATGATATCGGTGTGAATGCCAAAGCAATGACTGGCTATCAA
    GCGGGTATTAAAACCATTGGCCATCATTTAAAAAGTAAAATTGCTCAAATTAATCCTCAA
    ACATTTGAACAAGCCTTTCAAGAAAACGATATTTTAGTAGTTGCTGGATTTCAAGGCATC
    AATGAACATCAGGAATTAACAACTTTAGGCAGAGGCGGTTCTGATACGACCGCTGTGGCA
    CTTGCTGTTAGTAATCAAATACCTTGTGAAATTTATACCGACGTTGATGGTGTGTATGCC
    ACTGACCCAAGACTTTTACCAAAGGCTAAACGACTAGACATCGTCTCATATGAAGAAATG
    ATGGAAATGAGCGCTTTAGGTGCTGGTGTACTTGAAACAAGAAGTGTTGAATTAGCTAAA
    AACTATAATATCCCTTTATATTTAGGAAAAACTTTATCGAACGTGAAAGGAACATGGATT
    ATGTCAAATGAAGAAATATTAGAGAAAAAAGCAGTTACTGGTGTGGCTTTGGATAAACAT
    ATGATGCATGTAACAATTAGTTATCCCCTACCTGACAATCAGCTACTTACCCAACTATTT
    ACGGAACTTGAAGAAGGTGCTGTAAATGTTGATATGATTTCACAAATCGTCAACTTGGAT
    GGGCTACAACTATCCTTCACGATTAAAGATAGTGATTTTCATCAAATTTCTATGATTCTT
    GAAACATTAAAGAATCAATATGAAGCATTAGCTTATAAAATCAATGAGCATTATGTCAAA
    ATTTCATTAATTGGCTCAGGCATGCGTGATATGTCAGGTGTGGCATCAAAAGCATTTTTG
    ACATTAATTGAAAATAATATACCTTTCTACCAAACAACAACATCTGAAATAAGTATTTCA
    TACGTCATTGATGATTTTAATGGGCAACAAGCGGTAGAAAAACTATATGACGCATTTAAC
    ATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1206

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS06960 [old locus tag: SA1225 ]
  • symbol: SA_RS06960
  • description: aspartate kinase
  • length: 401
  • theoretical pI: 4.70763
  • theoretical MW: 44342.5
  • GRAVY: -0.0533666

Function[edit | edit source]

  • reaction:
    EC 2.7.2.4?  ExPASy
    Aspartate kinase ATP + L-aspartate = ADP + 4-phospho-L-aspartate
  • TIGRFAM:
    Metabolism Amino acid biosynthesis Aspartate family aspartate kinase (TIGR00657; EC 2.7.2.4; HMM-score: 354.5)
    Metabolism Amino acid biosynthesis Aspartate family aspartate kinase, monofunctional class (TIGR00656; EC 2.7.2.4; HMM-score: 331.8)
    and 4 more
    Metabolism Amino acid biosynthesis Aspartate family putative Pyrococcus aspartate kinase subunit (TIGR02078; EC 2.7.2.4; HMM-score: 105.3)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions UMP kinase (TIGR02075; EC 2.7.4.22; HMM-score: 36.4)
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides Nucleotide and nucleoside interconversions putative uridylate kinase (TIGR02076; EC 2.7.4.-; HMM-score: 32.3)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine thiamine pyrophosphokinase (TIGR01378; EC 2.7.6.2; HMM-score: 16.1)
  • TheSEED:
  • PFAM:
    no clan defined AA_kinase; Amino acid kinase family (PF00696; HMM-score: 146.8)
    and 3 more
    ACT (CL0070) ACT_7; ACT domain (PF13840; HMM-score: 27.5)
    no clan defined TPK_catalytic; Thiamin pyrophosphokinase, catalytic domain (PF04263; HMM-score: 20.3)
    E-set (CL0159) Alpha_adaptinC2; Adaptin C-terminal domain (PF02883; HMM-score: 14.8)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004219
    • TAT(Tat/SPI): 0.000769
    • LIPO(Sec/SPII): 0.000608
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446180861 NCBI
  • RefSeq: WP_000258716 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MVTRSVLKFGGSSVSDFTKIKRIAEMLKERVNQDEQLIVVVSAMGNTTDQLMTNVSTLTKAPKQQELALLLTTGEQQTVSYLSMVLNDIGVNAKAMTGYQAGIKTIGHHLKSKIAQINPQTFEQAFQENDILVVAGFQGINEHQELTTLGRGGSDTTAVALAVSNQIPCEIYTDVDGVYATDPRLLPKAKRLDIVSYEEMMEMSALGAGVLETRSVELAKNYNIPLYLGKTLSNVKGTWIMSNEEILEKKAVTGVALDKHMMHVTISYPLPDNQLLTQLFTELEEGAVNVDMISQIVNLDGLQLSFTIKDSDFHQISMILETLKNQYEALAYKINEHYVKISLIGSGMRDMSGVASKAFLTLIENNIPFYQTTTSEISISYVIDDFNGQQAVEKLYDAFNI

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]