From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS08185 [old locus tag: SA1452 ]
  • pan locus tag?: SAUPAN004227000
  • symbol: SA_RS08185
  • pan gene symbol?: csbD
  • synonym:
  • product: CsbD family protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS08185 [old locus tag: SA1452 ]
  • symbol: SA_RS08185
  • product: CsbD family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1657338..1657520
  • length: 183
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002745 (1657338..1657520) NCBI
  • BioCyc: SA_RS08185 BioCyc
  • MicrobesOnline: see SA1452

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCAGACGAAAGTAAGTTCGATCAATTTAAAGGAAATGTTAAAGAAACAGTAGGTAAC
    GTTACTGATAACAAAGAATTAGAAAAAGAAGGTCAGCAAGATAAAGCGACTGGTAAAGCA
    AAAGAAGTTGTTGAAAATGCTAAAAACAAAATAACTGATGCAATTGATAAACTTAAAAAA
    TAA
    60
    120
    180
    183

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SA_RS08185 [old locus tag: SA1452 ]
  • symbol: SA_RS08185
  • description: CsbD family protein
  • length: 60
  • theoretical pI: 6.85884
  • theoretical MW: 6682.43
  • GRAVY: -1.255

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SA1452
  • PFAM:
    YjbJ-CsbD-like (CL0406) CsbD; CsbD-like (PF05532; HMM-score: 55.6)
    and 2 more
    no clan defined YtxH; YtxH-like protein (PF12732; HMM-score: 12.3)
    HSP9_HSP12; Heat shock protein 9/12 (PF04119; HMM-score: 10.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0.24
    • Cytoplasmic Membrane Score: 0.05
    • Cellwall Score: 0.8
    • Extracellular Score: 8.91
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012794
    • TAT(Tat/SPI): 0.00341
    • LIPO(Sec/SPII): 0.004604
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MADESKFDQFKGNVKETVGNVTDNKELEKEGQQDKATGKAKEVVENAKNKITDAIDKLKK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SA_RS08185&oldid=87051"