From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS09985 [old locus tag: SAS056 ]
  • pan locus tag?: SAUPAN004972000
  • symbol: SA_RS09985
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS09985 [old locus tag: SAS056 ]
  • symbol: SA_RS09985
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1992474..1992647
  • length: 174
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (1992474..1992647) NCBI
  • BioCyc: SA_RS09985 BioCyc
  • MicrobesOnline: see SAS056

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGTGGAATTTTATTAAATGTGTGTTTAAATTCGTATTTAGCTTAGTTGCTATTACAACA
    TTAGTTGCTGGTGTTGGTGTAGTAGCATTTGCTTATATCTTTAAAAAAGATTTTGAAGAT
    ATTGAAAGAAAAACTAAAGAAATTATTTCTGATATTGAAAGTAAAAATAACTAA
    60
    120
    174


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS09985 [old locus tag: SAS056 ]
  • symbol: SA_RS09985
  • description: hypothetical protein
  • length: 57
  • theoretical pI: 8.49847
  • theoretical MW: 6564.7
  • GRAVY: 0.445614

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein modification and repair cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
    Metabolism Energy metabolism Electron transport cytochrome oxidase maturation protein, cbb3-type (TIGR00847; HMM-score: 20.2)
  • TheSEED: see SAS056
  • PFAM:
    no clan defined FixS; Cytochrome oxidase maturation protein cbb3-type (PF03597; HMM-score: 16.3)
    and 1 more
    DUF3918; Protein of unknown function (DUF3918) (PF13056; HMM-score: 11.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.4646
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.5348
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.384612
    • TAT(Tat/SPI): 0.007845
    • LIPO(Sec/SPII): 0.041173
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MWNFIKCVFKFVFSLVAITTLVAGVGVVAFAYIFKKDFEDIERKTKEIISDIESKNN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]