PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SA_RS10520 [old locus tag: SA1833 ]
• pan locus tag^?: SAUPAN005253000
• symbol: SA_RS10520
• pan gene symbol^?: —
• synonym:
• product: transcriptional regulator

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SA_RS10520 [old locus tag: SA1833 ]
• symbol: SA_RS10520
• product: transcriptional regulator
• replicon: chromosome
• strand: -
• coordinates: 2070021..2070239
• length: 219
• essential: no DEG

⊟Accession numbers

• Location: NC_002745 (2070021..2070239) NCBI
• BioCyc: SA_RS10520 BioCyc
• MicrobesOnline: see SA1833

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  ATGACTATTTTAGCGAATACTAGAAAGTTTAAAGAAGCCATGTTCTTAAAAGGCTTTAAT
  TTATCTGATTTATCACGTGAAACAGGTGTTGGAATTTCTTATTTAAGCCAAATTATTAAT
  GGTAAAAAGATTCCAAGCCCTAAATTAGCTAAGAAAATGGCAGAAGTTTTACAAGTTGAG
  GTAAATGAATTATTTGAATTTGAAGTAAAGGAGGCATAA
  60
  120
  180
  219
  

⊟Protein

⊟General

• locus tag: SA_RS10520 [old locus tag: SA1833 ]
• symbol: SA_RS10520
• description: transcriptional regulator
• length: 72
• theoretical pI: 9.75783
• theoretical MW: 8120.51
• GRAVY: -0.0861111

⊟Function

• TIGRFAM:
  Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 14.8)
  Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.3)
  Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.3)
  Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.3)
  Cellular processes Cellular processes Detoxification cyanase (TIGR00673; EC 4.2.1.104; HMM-score: 13.2)
  Hypothetical proteins Conserved TIGR02147 family protein (TIGR02147; HMM-score: 12.8)
• TheSEED: see SA1833
• PFAM:
  HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 46.5)
  and 4 more
  HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 36.5)
  HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 25.8)
  HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 24.3)
  HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 17.2)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: unknown (no significant prediction)
  • Cytoplasmic Score: 2.5
  • Cytoplasmic Membrane Score: 2.5
  • Cellwall Score: 2.5
  • Extracellular Score: 2.5
  • Internal Helices: 0
• LocateP:
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.002044
  • TAT(Tat/SPI): 0.000725
  • LIPO(Sec/SPII): 0.000339
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 446075785 NCBI
• RefSeq: WP_000153640 NCBI
• UniProt: see SA1833

⊟Protein sequence

• MTILANTRKFKEAMFLKGFNLSDLSRETGVGISYLSQIINGKKIPSPKLAKKMAEVLQVEVNELFEFEVKEA

⊟Experimental data

• experimentally validated:
• protein localization:
• quantitative data / protein copy number per cell:
• interaction partners:

⊟Expression & Regulation

⊟Operon

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: no data available

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications