Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA1833 [new locus tag: SA_RS10520 ]
- pan locus tag?: SAUPAN005253000
- symbol: SA1833
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA1833 [new locus tag: SA_RS10520 ]
- symbol: SA1833
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2070021..2070239
- length: 219
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1124725 NCBI
- RefSeq: NP_375134 NCBI
- BioCyc: see SA_RS10520
- MicrobesOnline: 104160 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGACTATTTTAGCGAATACTAGAAAGTTTAAAGAAGCCATGTTCTTAAAAGGCTTTAAT
TTATCTGATTTATCACGTGAAACAGGTGTTGGAATTTCTTATTTAAGCCAAATTATTAAT
GGTAAAAAGATTCCAAGCCCTAAATTAGCTAAGAAAATGGCAGAAGTTTTACAAGTTGAG
GTAAATGAATTATTTGAATTTGAAGTAAAGGAGGCATAA60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA1833 [new locus tag: SA_RS10520 ]
- symbol: SA1833
- description: hypothetical protein
- length: 72
- theoretical pI: 9.75783
- theoretical MW: 8120.51
- GRAVY: -0.0861111
⊟Function[edit | edit source]
- TIGRFAM: Mobile and extrachromosomal element functions Prophage functions phage-associated protein, BcepMu gp16 family (TIGR04111; HMM-score: 14.8)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.3)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.3)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 14.3)Cellular processes Detoxification cyanase (TIGR00673; EC 4.2.1.104; HMM-score: 13.2)Hypothetical proteins Conserved TIGR02147 family protein (TIGR02147; HMM-score: 12.8)
- TheSEED :
- Hypothetical SAV2026 homolog in superantigen-encoding pathogenicity islands SaPI
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 47.7)and 4 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 30.8)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 25)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 24.8)HTH_35; Winged helix-turn-helix DNA-binding (PF13693; HMM-score: 17.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9766
- Cytoplasmic Membrane Score: 0.0034
- Cell wall & surface Score: 0.0032
- Extracellular Score: 0.0168
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002044
- TAT(Tat/SPI): 0.000725
- LIPO(Sec/SPII): 0.000339
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTILANTRKFKEAMFLKGFNLSDLSRETGVGISYLSQIINGKKIPSPKLAKKMAEVLQVEVNELFEFEVKEA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]