From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS10565 [old locus tag: SAS065 ]
  • pan locus tag?: SAUPAN005274000
  • symbol: SA_RS10565
  • pan gene symbol?: hld
  • synonym:
  • product: delta-hemolysin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS10565 [old locus tag: SAS065 ]
  • symbol: SA_RS10565
  • product: delta-hemolysin
  • replicon: chromosome
  • strand: -
  • coordinates: 2079076..2079210
  • length: 135
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2079076..2079210) NCBI
  • BioCyc: G1G21-2135 BioCyc
  • MicrobesOnline: see SAS065

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGTTGTTTAATTTTAAGAATTTTTATCTTAATTAAGGAAGGAGTGATTTCAATGGCA
    CAAGATATCATTTCAACAATCGGTGACTTAGTAAAATGGATTATCGACACAGTGAACAAA
    TTCACTAAAAAATAA
    60
    120
    135

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS10565 [old locus tag: SAS065 ]
  • symbol: SA_RS10565
  • description: delta-hemolysin
  • length: 44
  • theoretical pI: 9.46068
  • theoretical MW: 5009.12
  • GRAVY: 0.802273

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SAS065
  • PFAM:
    no clan defined Delta_lysin; Delta lysin family (PF05372; HMM-score: 71.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.098909
    • TAT(Tat/SPI): 0.001539
    • LIPO(Sec/SPII): 0.021637
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]