From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12765 [old locus tag: SA2223 ]
  • pan locus tag?: SAUPAN005983000
  • symbol: SA_RS12765
  • pan gene symbol?:
  • synonym:
  • product: AraC family transcriptional regulator

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS12765 [old locus tag: SA2223 ]
  • symbol: SA_RS12765
  • product: AraC family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2495654..2496127
  • length: 474
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (2495654..2496127) NCBI
  • BioCyc: G1G21-2590 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGAATATCAATTACAACAACTTGCGTCGTTAACGTTAGTAGGTATTAAAGAAACGTAT
    GAAAATGGACGACAGGCTCAGCAACATATAGCCGGGTTTTGGCAAAGGTGTTATCAAGAG
    GGAGTAATTGCGGATTTACAGTTAAAAAATAATGGTGATTTAGCCGGGATACTTGGCTTA
    TGTATACCCGAATTAGACGGTAAGATGTCATATATGATTGCAGTTACCGGAGATAATAGT
    GCTGATATTGCAAAATATGATGTCATAACATTAGCAAGTTCAAAGTATATGGTATTTGAA
    GCACAGGGCGCAGTACCTAAAGCAGTTCAACAAAAAATGGAAGAGGTTCATCACTACATA
    CATCAATATCAAGCAAATACGGTAAAATCAGCACCATTTTTTGAGTTGTATCAGGATGGT
    GATACTACAAGTGAAAAATATATTACAGAAATTTGGATGCCTGTTAAAGGGTGA
    60
    120
    180
    240
    300
    360
    420
    474

Protein[edit | edit source]

Protein Data Bank: 5KAT
Protein Data Bank: 5KAU
Protein Data Bank: 5KAV
Protein Data Bank: 5KAW
Protein Data Bank: 5KCB

General[edit | edit source]

  • locus tag: SA_RS12765 [old locus tag: SA2223 ]
  • symbol: SA_RS12765
  • description: AraC family transcriptional regulator
  • length: 157
  • theoretical pI: 4.74963
  • theoretical MW: 17660.9
  • GRAVY: -0.284076

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:
  • PFAM:
    SHS2 (CL0319) GyrI-like; GyrI-like small molecule binding domain (PF06445; HMM-score: 49.2)
    Cass2; Integron-associated effector binding protein (PF14526; HMM-score: 45.5)
    and 2 more
    no clan defined AKAP7_RIRII_bdg; PKA-RI-RII subunit binding domain of A-kinase anchor protein (PF10470; HMM-score: 12.9)
    NADP_Rossmann (CL0063) NAS; Nicotianamine synthase protein (PF03059; HMM-score: 11.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.019187
    • TAT(Tat/SPI): 0.000909
    • LIPO(Sec/SPII): 0.001978
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446378631 NCBI
  • RefSeq: WP_000456486 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MEYQLQQLASLTLVGIKETYENGRQAQQHIAGFWQRCYQEGVIADLQLKNNGDLAGILGLCIPELDGKMSYMIAVTGDNSADIAKYDVITLASSKYMVFEAQGAVPKAVQQKMEEVHHYIHQYQANTVKSAPFFELYQDGDTTSEKYITEIWMPVKG

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]