From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS12895 [old locus tag: SA2245 ]
  • pan locus tag?: SAUPAN006013000
  • symbol: SA_RS12895
  • pan gene symbol?:
  • synonym:
  • product: Txe/YoeB family addiction module toxin

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS12895 [old locus tag: SA2245 ]
  • symbol: SA_RS12895
  • product: Txe/YoeB family addiction module toxin
  • replicon: chromosome
  • strand: -
  • coordinates: 2522494..2522760
  • length: 267
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2522494..2522760) NCBI
  • BioCyc: SA_RS12895 BioCyc
  • MicrobesOnline: see SA2245

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAGCAATTACACGGTTAAGATTAAAAATTCAGCGAAATCAGATTTAAGGAAAATAAAA
    CATTCTTATTTAAAGAAGTCATTTTTAGAAATTGTTGAGACTTTAAAAAATGATCCGTAT
    AAAATAACACAATCTTTTGAAAAATTAGAGCCTAAATATTTAGAGCGATATTCAAGAAGA
    ATTAACCATCAGCACAGGGTCGTCTATACCGTAGATGATCGAAATAAAGAAGTATTAATA
    CTATCGGCATGGTCACATTATGATTAA
    60
    120
    180
    240
    267

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS12895 [old locus tag: SA2245 ]
  • symbol: SA_RS12895
  • description: Txe/YoeB family addiction module toxin
  • length: 88
  • theoretical pI: 10.1626
  • theoretical MW: 10676.2
  • GRAVY: -0.898864

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 97.9)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, Txe/YoeB family (TIGR02116; HMM-score: 97.9)
    and 4 more
    Cellular processes Cellular processes Toxin production and resistance addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 19.6)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module toxin, RelE/StbE family (TIGR02385; HMM-score: 19.6)
    Signal transduction Regulatory functions Protein interactions HPr(Ser) kinase/phosphatase (TIGR00679; EC 2.7.1.-; HMM-score: 11.2)
    Signal transduction Signal transduction PTS HPr(Ser) kinase/phosphatase (TIGR00679; EC 2.7.1.-; HMM-score: 11.2)
  • TheSEED: see SA2245
  • PFAM:
    Plasmid_toxin (CL0136) YoeB_toxin; YoeB-like toxin of bacterial type II toxin-antitoxin system (PF06769; HMM-score: 38.2)
    and 6 more
    ParE_toxin; ParE toxin of type II toxin-antitoxin system, parDE (PF05016; HMM-score: 29.4)
    HigB-like_toxin; RelE-like toxin of type II toxin-antitoxin system HigB (PF05015; HMM-score: 19.6)
    no clan defined TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 17.3)
    Met_repress (CL0057) VAPB_antitox; Putative antitoxin (PF02697; HMM-score: 15)
    Plasmid_toxin (CL0136) ParE-like_toxin; ParE-like toxin of type II bacterial toxin-antitoxin system (PF15781; HMM-score: 13.1)
    HAD (CL0137) HAD_PNKP; Polynucleotide kinase PNKP phosphatase domain (PF25109; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9851
    • Cytoplasmic Membrane Score: 0.001
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.0134
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003947
    • TAT(Tat/SPI): 0.000216
    • LIPO(Sec/SPII): 0.000514
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MSNYTVKIKNSAKSDLRKIKHSYLKKSFLEIVETLKNDPYKITQSFEKLEPKYLERYSRRINHQHRVVYTVDDRNKEVLILSAWSHYD

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]