Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS13040 [old locus tag: SA2271 ]
- pan locus tag?: SAUPAN006070000
- symbol: SA_RS13040
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGTTTACTACGTATAAAAATATTAATGAACTTGAAAATGCCTATGATGAAGAAAGAAAA
CAATTGAATGATGCATTCAATCAAATTGATGAATTAAGACATCAAACACGCAAGAAATGT
GAACAAATGTATGATCATTTCTTATATCTCAAACATAAAATGAATTATAGTGAAGACGCT
ATGATCAGGATGACACGTATTATAGAATCTTTCGATAGAGAAACGAATCAACGTATCCGA
CATCACGAAATGAAATTAGAAGATTATAAAGATGAGTTAAGAAGAGAATATCTAAAACAA
TCTGACAGAATTGAAGGAGATGAATAA60
120
180
240
300
327
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS13040 [old locus tag: SA2271 ]
- symbol: SA_RS13040
- description: hypothetical protein
- length: 108
- theoretical pI: 5.63959
- theoretical MW: 13586.1
- GRAVY: -1.45
⊟Function[edit | edit source]
- TIGRFAM: two transmembrane protein (TIGR04527; HMM-score: 9.7)and 3 moreDNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 7.2)Protein fate Protein folding and stabilization chaperone protein DnaK (TIGR02350; HMM-score: 6.9)variant surface antigen, rifin family (TIGR01477; HMM-score: 5.3)
- TheSEED: see SA2271
- PFAM: TPR (CL0020) CHIP_TPR_N; CHIP N-terminal tetratricopeptide repeat domain (PF18391; HMM-score: 15.7)HTH (CL0123) wHTH_TTC3; TTC3-like, winged helix turn helix domain (PF24812; HMM-score: 15)no clan defined SWIRM-assoc_1; SWIRM-associated region 1 (PF16495; HMM-score: 13.9)Biopterin_H; Biopterin-dependent aromatic amino acid hydroxylase (PF00351; HMM-score: 13.6)AATF-Che1; Apoptosis antagonizing transcription factor (PF13339; HMM-score: 13.3)DUF3106; Protein of unknown function (DUF3106) (PF11304; HMM-score: 12.9)and 10 moreExonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 12.2)ZapG-like; Z-ring associated protein G-like (PF06295; HMM-score: 10.8)DUF5798; Family of unknown function (DUF5798) (PF19111; HMM-score: 10.7)DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10.6)Amidase; Amidase (PF01425; HMM-score: 10.2)Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 9.9)V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 9.4)PhoU (CL0297) PhoU; PhoU domain (PF01895; HMM-score: 8.6)no clan defined CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 8.2)Pec_lyase-like (CL0268) FapA; Flagellar Assembly Protein A beta solenoid domain (PF03961; HMM-score: 6.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.511
- Cytoplasmic Membrane Score: 0.1321
- Cell wall & surface Score: 0.0077
- Extracellular Score: 0.3492
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004856
- TAT(Tat/SPI): 0.000517
- LIPO(Sec/SPII): 0.001212
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MFTTYKNINELENAYDEERKQLNDAFNQIDELRHQTRKKCEQMYDHFLYLKHKMNYSEDAMIRMTRIIESFDRETNQRIRHHEMKLEDYKDELRREYLKQSDRIEGDE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]