From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13230 [old locus tag: SA2307 ]
  • pan locus tag?: SAUPAN006163000
  • symbol: SA_RS13230
  • pan gene symbol?: mhqD
  • synonym:
  • product: ring-cleaving dioxygenase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13230 [old locus tag: SA2307 ]
  • symbol: SA_RS13230
  • product: ring-cleaving dioxygenase
  • replicon: chromosome
  • strand: -
  • coordinates: 2592973..2593932
  • length: 960
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (2592973..2593932) NCBI
  • BioCyc: G1G21-2687 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGATAAATAATCATGAATTACTAGGTATTCACCATGTCACAGCAATGACAGATGATGCA
    GAACGTAATTATAAATTTTTTACAGAAGTATTAGGCATGCGTTTAGTTAAAAAGACAGTC
    AATCAAGATGATATTTATACGTATCATACATTTTTTGCAGATGATGTAGGTTCAGCAGGT
    ACAGATATGACATTCTTTGATTTTCCAAATATTACAAAAGGGCAGGCAGGAACAAATTCC
    ATTACAAGACCGTCTTTTAGAGTGCCTAACGATGACGCATTAATGTATTATGAACAGCGC
    TTTGATGAATTTGGTGTTAAACACGAAGGTATTCAAGAATTATTTGGTAAAAAAGTGTTG
    CCATTTGAAGAAGTCGATGGCCAAGTGTATCAATTAATTTCAGATGAGTTAAATGATGGG
    GTAGCACCTGGTGTACCTTGGAAGAATGGACCGGTTCCAGTAGATAAAGCGATTTATGGA
    TTAGGACCCATTGAAATTAAAGTAAGTTATTTTGACGACTTTAAAAATATTTTAGAGACT
    GTTTACGGTATGACAACTATTGCGCATGAAGATAATGTCGCATTACTTGAAGTTGGCGAA
    GGCGGCAATGGTGGCCAGGTAATCTTAATAAAAGATGATAAAGGGCCAGCAGCACGTCAA
    GGTTATGGTGAGGTACATCATGTGTCATTTCGTGTGAAAGATCATGATGCAATAGAAGCG
    TGGGCAACGAAATATAAAGAGGTAGGTATTAACAACTCAGGCATCGTTAATCGTTTCTAT
    TTTGAAGCATTATATGCACGTGTGGGGCATATTTTAATAGAAATTTCAACAGATGGACCA
    GGATTTATGGAAGATGAACCGTATGAAACATTAGGTGAAGGTTTATCATTGCCACCATTT
    TTAGAAAATAAAAGAGAGTATATAGAATCAGAAATAAGACCATTTAATACTAAGCGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13230 [old locus tag: SA2307 ]
  • symbol: SA_RS13230
  • description: ring-cleaving dioxygenase
  • length: 319
  • theoretical pI: 4.53654
  • theoretical MW: 35950
  • GRAVY: -0.389028

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Other catechol 2,3 dioxygenase (TIGR03211; EC 1.13.11.2; HMM-score: 28.5)
    3,4-dihydroxyphenylacetate 2,3-dioxygenase (TIGR02295; EC 1.13.11.15; HMM-score: 28.4)
    and 4 more
    Metabolism Energy metabolism Other lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 19.3)
    Metabolism Central intermediary metabolism Amino sugars lactoylglutathione lyase (TIGR00068; EC 4.4.1.5; HMM-score: 19.3)
    methylmalonyl-CoA epimerase (TIGR03081; EC 5.1.99.1; HMM-score: 17.4)
    Metabolism Energy metabolism Other 2,3-dihydroxybiphenyl 1,2-dioxygenase (TIGR03213; EC 1.13.11.39; HMM-score: 17)
  • TheSEED:
  • PFAM:
    Glyoxalase (CL0104) Glyoxalase; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903; HMM-score: 83.8)
    and 1 more
    Glyoxalase_4; Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF13669; HMM-score: 24.1)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004016
    • TAT(Tat/SPI): 0.000237
    • LIPO(Sec/SPII): 0.000581
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446532000 NCBI
  • RefSeq: WP_000609346 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MINNHELLGIHHVTAMTDDAERNYKFFTEVLGMRLVKKTVNQDDIYTYHTFFADDVGSAGTDMTFFDFPNITKGQAGTNSITRPSFRVPNDDALMYYEQRFDEFGVKHEGIQELFGKKVLPFEEVDGQVYQLISDELNDGVAPGVPWKNGPVPVDKAIYGLGPIEIKVSYFDDFKNILETVYGMTTIAHEDNVALLEVGEGGNGGQVILIKDDKGPAARQGYGEVHHVSFRVKDHDAIEAWATKYKEVGINNSGIVNRFYFEALYARVGHILIEISTDGPGFMEDEPYETLGEGLSLPPFLENKREYIESEIRPFNTKR

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]