Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA_RS13240 [old locus tag: SA2309 ]
- pan locus tag?: SAUPAN006165000
- symbol: SA_RS13240
- pan gene symbol?: —
- synonym:
- product: N-acetyltransferase
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA_RS13240 [old locus tag: SA2309 ]
- symbol: SA_RS13240
- product: N-acetyltransferase
- replicon: chromosome
- strand: +
- coordinates: 2594670..2594954
- length: 285
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAGTAACCTTGAAATCAAACAAGGCGAGAACAAATTCTATATTGGTGATGATGAAAAT
AATGCTTTAGCTGAAATCACATACCGTTTTGTGGATAATAATGAAATTAACATTGATCAT
ACAGGCGTATCTGATGAACTTGGTGGTCAAGGTGTTGGCAAAAAACTAGTTAAAGCAGTT
GTTGAACACGCTCGAGAAAATCATTTAAAAATTATTGCCTCATGTTCATTTGCCAAACAT
ATGTTAGAAAAAGAAGATTCATATCAAGATGTATATCTTGGTTAA60
120
180
240
285
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA_RS13240 [old locus tag: SA2309 ]
- symbol: SA_RS13240
- description: N-acetyltransferase
- length: 94
- theoretical pI: 4.69592
- theoretical MW: 10556.7
- GRAVY: -0.551064
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 20.1)and 1 moremethanogenesis imperfect marker protein 11 (TIGR03280; HMM-score: 12.6)
- TheSEED: see SA2309
- PFAM: Acetyltrans (CL0257) Acetyltransf_CG; GCN5-related N-acetyl-transferase (PF14542; HMM-score: 89.4)and 4 moreAcetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 27.2)Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 26.8)Acetyltransf_7; Acetyltransferase (GNAT) domain (PF13508; HMM-score: 16.3)6PGD_C (CL0106) IlvC; Acetohydroxy acid isomeroreductase, catalytic domain (PF01450; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003576
- TAT(Tat/SPI): 0.000194
- LIPO(Sec/SPII): 0.000358
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNLEIKQGENKFYIGDDENNALAEITYRFVDNNEINIDHTGVSDELGGQGVGKKLVKAVVEHARENHLKIIASCSFAKHMLEKEDSYQDVYLG
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]