From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13605 [old locus tag: SA2376 ]
  • pan locus tag?: SAUPAN006270000
  • symbol: SA_RS13605
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13605 [old locus tag: SA2376 ]
  • symbol: SA_RS13605
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2665292..2665567
  • length: 276
  • essential: no DEG other strains

Accession numbers[edit | edit source]

  • Location: NC_002745 (2665292..2665567) NCBI
  • BioCyc: SA_RS13605 BioCyc
  • MicrobesOnline: see SA2376

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACTAAAGAAACAGATAATAAAAAAACAGTAGCGACTTCTGACAACAAAGACACACAG
    CAACAAAATCAAACTGAAGAAGATGAACGTCAAGGTTTGAATGGTTATCGTAAAACAGAT
    CTTGATTTAGAAATTGAGCAAGAGCTACGTGAAATGATGAAAACAGGAGAAAATGAAACG
    AAAAACGACTACAAAAAGTTTAAAGTGTTTTCACTTATTTCAACACTTGTCATTGTCATT
    TTAGCAATTATAAGATTTGTTCATAAAATGATTTAA
    60
    120
    180
    240
    276

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13605 [old locus tag: SA2376 ]
  • symbol: SA_RS13605
  • description: hypothetical protein
  • length: 91
  • theoretical pI: 5.21911
  • theoretical MW: 10698.1
  • GRAVY: -0.88022

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein folding and stabilization cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
    Metabolism Energy metabolism Electron transport cytochrome c-type biogenesis protein CcmI (TIGR03142; HMM-score: 12.5)
  • TheSEED: see SA2376
  • PFAM:
    Reductase_C (CL0608) AIF_C; Apoptosis-inducing factor, mitochondrion-associated, C-term (PF14721; HMM-score: 13.8)
    and 2 more
    no clan defined DUF6548; Family of unknown function (DUF6548) (PF20185; HMM-score: 10.7)
    EssA; WXG100 protein secretion system (Wss), protein EssA (PF10661; HMM-score: 7.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9955
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0044
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011608
    • TAT(Tat/SPI): 0.005388
    • LIPO(Sec/SPII): 0.002872
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKETDNKKTVATSDNKDTQQQNQTEEDERQGLNGYRKTDLDLEIEQELREMMKTGENETKNDYKKFKVFSLISTLVIVILAIIRFVHKMI

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]