From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA_RS13635 [old locus tag: SA2381 ]
  • pan locus tag?: SAUPAN006279000
  • symbol: SA_RS13635
  • pan gene symbol?: sasK
  • synonym:
  • product: peptidase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA_RS13635 [old locus tag: SA2381 ]
  • symbol: SA_RS13635
  • product: peptidase
  • replicon: chromosome
  • strand: -
  • coordinates: 2669869..2670504
  • length: 636
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002745 (2669869..2670504) NCBI
  • BioCyc: G1G21-2770 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGAAAAAAGTTATAAGTTTATTTGTTGCAATTTTATCAGTGTTGATTTTTACGGATAAT
    GCGAACGCCGAAAATAACAAACCTGAAGGTGTGAATGAAAACAGCAATTTAATACCAGTT
    AGACAACCGGATGCAAATTATCCAGGGCCAGTTAGTGACATAGCACGTGTGAAAAAACTT
    GATAATTTAATAGATGGCACGAAAGATCCAAATGTTATCAAGCAGTTGAAAGATGATAAT
    GAGGTGCCGAATAATGCGGTAAAGGCAAAAGATTCTAAAATAGTATCCGACTGCAGACAT
    TTACTAAAACATCCAGATAATTTAATAGATGGCACGAAAGATCCAAATGTTATTAATCAG
    TTGAAAAACGCAAATGGAACATCGAATAATAGTGCTGTAAATCCAAGTATTAAAGCAAAT
    GATATTCACACAAAAAGTAATAAACAAATGGCTAAACAACAAAGTATTCATTTGGATAGC
    AAGAGCAAGTCAGTACATAAGCAACAATTGAAAGAATTGCCAAAAACAGGAGTAAACAAC
    GAAAGTAATACAGCAATAATGGCTTTATTTATTGGTTTAATATTGCTTGTAGTAAGTTTA
    GTGACAAGATTTATAAAATTAAATAGCCATCAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    636

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA_RS13635 [old locus tag: SA2381 ]
  • symbol: SA_RS13635
  • description: peptidase
  • length: 211
  • theoretical pI: 10.1625
  • theoretical MW: 23177.3
  • GRAVY: -0.475355

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 17.3)
  • TheSEED:
  • PFAM:
    no clan defined Gram_pos_anchor; LPXTG cell wall anchor motif (PF00746; HMM-score: 26)
    and 6 more
    eIF3_N; eIF3 subunit 6 N terminal domain (PF09440; HMM-score: 15.5)
    DUF5383; Family of unknown function (DUF5383) (PF17355; HMM-score: 15.4)
    Glycophorin_A; Glycophorin A (PF01102; HMM-score: 14.6)
    DUF3899; Domain of unknown function (DUF3899) (PF13038; HMM-score: 12.6)
    DUF3188; Protein of unknown function (DUF3188) (PF11384; HMM-score: 12.2)
    Peptidase_CA (CL0125) Menin; Menin (PF05053; HMM-score: 11.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 10
    • Extracellular Score: 0
    • Internal Helix: 1
  • LocateP:
  • SignalP: Signal peptide SP(Sec/SPI) length 23 aa
    • SP(Sec/SPI): 0.995633
    • TAT(Tat/SPI): 0.000316
    • LIPO(Sec/SPII): 0.002572
    • Cleavage Site: CS pos: 23-24. ANA-EN. Pr: 0.9834
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

  • GI: 446678645 NCBI
  • RefSeq: WP_000755991 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MKKVISLFVAILSVLIFTDNANAENNKPEGVNENSNLIPVRQPDANYPGPVSDIARVKKLDNLIDGTKDPNVIKQLKDDNEVPNNAVKAKDSKIVSDCRHLLKHPDNLIDGTKDPNVINQLKNANGTSNNSAVNPSIKANDIHTKSNKQMAKQQSIHLDSKSKSVHKQQLKELPKTGVNNESNTAIMALFIGLILLVVSLVTRFIKLNSHQ

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]