From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2550 [new locus tag: SACOL_RS13350 ]
  • pan locus tag?: SAUPAN006190000
  • symbol: SACOL2550
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2550 [new locus tag: SACOL_RS13350 ]
  • symbol: SACOL2550
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2607795..2608139
  • length: 345
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGTTAAGCAATTAAATAGTGTCGAAGCATTCCGTGAATTTATTCATCAATATCCGTTA
    GCAGTTGTACATGTCATGCGCGATCAGTGTAGCGTGTGTCATGCCGTTTTACCACAAATT
    GAAGACTTGATGCAATCATATCCCAATGTGCCATTAGCTGTGATTAATCAAAGTCAGGTG
    GAAGCTATTGCTGGAGAATTAAATATTTTCACTGTACCTGTGGATTTAATTTTTATGAAT
    GGAAAAGAAATGCATCGTCAAGGGCGTTTTATCGATATGCAACGTTTTGAACATCATCTT
    AAGCAAATGAATGATAGTGTAAATAACGATGTCGATGAGCATTAA
    60
    120
    180
    240
    300
    345

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2550 [new locus tag: SACOL_RS13350 ]
  • symbol: SACOL2550
  • description: hypothetical protein
  • length: 114
  • theoretical pI: 5.4387
  • theoretical MW: 13215.1
  • GRAVY: -0.192982

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Electron transport thioredoxin (TIGR01068; HMM-score: 32.8)
    and 1 more
    type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB (TIGR02738; HMM-score: 12.6)
  • TheSEED  :
    • Thioredoxin
    Prolyl-tRNA synthetase associated editing enzymes  Thioredoxin
  • PFAM:
    Thioredoxin (CL0172) Thioredoxin; Thioredoxin (PF00085; HMM-score: 33)
    and 5 more
    Thioredoxin_3; Thioredoxin domain (PF13192; HMM-score: 17.7)
    CDA (CL0109) Toxin-deaminase; The BURPS668_1122 family of deaminases (PF14424; HMM-score: 12.8)
    Cytochrome-c (CL0318) Cytochrom_C1; Cytochrome C1 family (PF02167; HMM-score: 12.6)
    LDH_C (CL0341) Ldh_1_C; lactate/malate dehydrogenase, alpha/beta C-terminal domain (PF02866; HMM-score: 12.1)
    Thioredoxin (CL0172) Phosducin; Phosducin (PF02114; HMM-score: 11.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007366
    • TAT(Tat/SPI): 0.001573
    • LIPO(Sec/SPII): 0.001509
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQVEAIAGELNIFTVPVDLIFMNGKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell: 98 [2]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]