From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01627
  • pan locus tag?: SAUPAN004108000
  • symbol: SAOUHSC_01627
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01627
  • symbol: SAOUHSC_01627
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1549370..1549951
  • length: 582
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAAAATTGGTTTCAATTGTTGGCGCAACATTATTGTTAGCTGGATGTGGATCACAA
    AATTTAGCACCATTAGAAGAAAAAACAACAGATTTAAGAGAAGATAATCATCAACTCAAA
    CTAGATATTCAAGAACTTAATCAACAAATTAGTGATTCTAAATCTAAAATTAAAGGGCTT
    GAAAAGGATAAAGAAAACAGTAAAAAAACTGCATCTAATAATACGAAAATTAAATTGATG
    AATGTTACATCAACATACTACGACAAAGTTGCTAAAGCTTTGAAATCCTATAACGATATT
    GAGAAAGATGTAAGTAAAAACAAAGGCGATAAGAATGTTCAATCGAAATTAAATCAAATT
    TCTAATGATATTCAAAGTGCTCACACTTCATACAAAGATGCTATCGATGGTTTATCACTT
    AGTGATGATGATAAAAAAACGTCTAAAAATATCGATAAATTAAACTCTGATTTGAATCAT
    GCATTTGATGATATTAAAAATGGCTATCAAAATAAAGATAAAAAACAACTTACAAAAGGA
    CAACAAGCGTTGTCAAAATTAAACTTAAATGCAAAATCATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    582

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01627
  • symbol: SAOUHSC_01627
  • description: hypothetical protein
  • length: 193
  • theoretical pI: 9.8465
  • theoretical MW: 21472
  • GRAVY: -0.999482

⊟Function[edit | edit source]

  • TIGRFAM:
    SH3 domain protein (TIGR04211; HMM-score: 14.2)
    and 6 more
    Cellular processes Cellular processes Pathogenesis type III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 11.2)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 7.3)
    phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.8)
    Metabolism Energy metabolism Photosynthesis photosystem II protein PsbQ (TIGR03042; HMM-score: 5.1)
  • TheSEED  :
    • FIG01108536: hypothetical protein
  • PFAM:
    OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 16.3)
    no clan defined Lzipper-MIP1; Leucine-zipper of ternary complex factor MIP1 (PF14389; HMM-score: 14.8)
    IncA; IncA protein (PF04156; HMM-score: 14.2)
    Syntaxin-6_N; Syntaxin 6, N-terminal (PF09177; HMM-score: 13.9)
    DUF4763; Domain of unknown function (DUF4763) (PF15960; HMM-score: 13.4)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 13.2)
    and 18 more
    HTH (CL0123) Mnd1; Mnd1 family (PF03962; HMM-score: 12.5)
    no clan defined DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 12.3)
    TMCO5; TMCO5 family (PF14992; HMM-score: 11.8)
    YabB; Initiation control protein YabA (PF06156; HMM-score: 11.6)
    PRKG1_interact; cGMP-dependent protein kinase interacting domain (PF15898; HMM-score: 11.1)
    LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 10.8)
    no clan defined DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 10.7)
    BCLiA (CL0551) APG6; Autophagy protein Apg6 (PF04111; HMM-score: 9.8)
    Vps51 (CL0295) COG2; COG (conserved oligomeric Golgi) complex component, COG2 (PF06148; HMM-score: 9.1)
    no clan defined Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 9.1)
    Jnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 8.1)
    FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 7.9)
    SNARE-fusion (CL0445) Syntaxin_2; Syntaxin-like protein (PF14523; HMM-score: 7.6)
    bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 7.4)
    FKBP (CL0487) Rotamase; PPIC-type PPIASE domain (PF00639; HMM-score: 7.4)
    no clan defined Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 7.2)
    GrpE; GrpE (PF01025; HMM-score: 6.5)
    Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 5.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 3.33
    • Cellwall Score: 3.33
    • Extracellular Score: 3.33
    • Internal Helices: 0
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: LLAGCGS
  • SignalP: Signal peptide LIPO(Sec/SPII) length 16 aa
    • SP(Sec/SPI): 0.000578
    • TAT(Tat/SPI): 0.000055
    • LIPO(Sec/SPII): 0.999143
    • Cleavage Site: CS pos: 16-17. LAG-CG. Pr: 0.9997
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKKLVSIVGATLLLAGCGSQNLAPLEEKTTDLREDNHQLKLDIQELNQQISDSKSKIKGLEKDKENSKKTASNNTKIKLMNVTSTYYDKVAKALKSYNDIEKDVSKNKGDKNVQSKLNQISNDIQSAHTSYKDAIDGLSLSDDDKKTSKNIDKLNSDLNHAFDDIKNGYQNKDKKQLTKGQQALSKLNLNAKS

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_01627&oldid=84877"