Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_1492 [new locus tag: SAUSA300_RS08145 ]
- pan locus tag?: SAUPAN004108000
- symbol: SAUSA300_1492
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_1492 [new locus tag: SAUSA300_RS08145 ]
- symbol: SAUSA300_1492
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1646167..1646748
- length: 582
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3914810 NCBI
- RefSeq: YP_494187 NCBI
- BioCyc: see SAUSA300_RS08145
- MicrobesOnline: 1293007 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGAAAAAATTGGTTTCAATTGTTGGCGCAACATTATTGTTAGCTGGATGTGGATCACAA
AATTTAGCACCATTAGAAGAAAAAACAACAGATTTAAGAGAAGATAATCATCAACTCAAA
CTAGATATTCAAGAACTTAATCAACAAATTAGTGATTCTAAATCTAAAATTAAAGGGCTT
GAAAAGGATAAAGAAAACAGTAAAAAAACTGCATCTAATAATACGAAAATTAAATTGATG
AATGTTACATCAACATACTACGACAAAGTTGCTAAAGCTTTGAAATCCTATAACGATATT
GAGAAAGATGTAAGTAAAAACAAAGGCGATAAGAATGTTCAATCGAAATTAAATCAAATT
TCTAATGATATTCAAAGTGCTCACACTTCATACAAAGATGCTATCGATGGTTTATCACTT
AGTGATGATGATAAAAAAACGTCTAAAAATATCGATAAATTAAACTCTGATTTGAATCAT
GCATTTGATGATATTAAAAATGGCTATCAAAATAAAGATAAAAAACAACTTACAAAAGGA
CAACAAGCGTTGTCAAAATTAAACTTAAATGCAAAATCATGA60
120
180
240
300
360
420
480
540
582
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAUSA300_1492 [new locus tag: SAUSA300_RS08145 ]
- symbol: SAUSA300_1492
- description: hypothetical protein
- length: 193
- theoretical pI: 9.8465
- theoretical MW: 21472
- GRAVY: -0.999482
⊟Function[edit | edit source]
- TIGRFAM: SH3 domain protein (TIGR04211; HMM-score: 14.2)and 6 moreCellular processes Pathogenesis type III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)Protein fate Protein and peptide secretion and trafficking type III secretion apparatus needle protein (TIGR02105; HMM-score: 11.3)Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 11.2)Mobile and extrachromosomal element functions Plasmid functions integrating conjugative element protein, PFL_4705 family (TIGR03752; HMM-score: 7.3)phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.8)Energy metabolism Photosynthesis photosystem II protein PsbQ (TIGR03042; HMM-score: 5.1)
- TheSEED :
- FIG01108536: hypothetical protein
- PFAM: Transthyretin (CL0287) T6_Ig_like; T6 antigen Ig like domain (PF18002; HMM-score: 16.9)LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 15.8)no clan defined TMCO5; TMCO5 family (PF14992; HMM-score: 15.6)DUF7449; Domain of unknown function (DUF7449) (PF24242; HMM-score: 14.1)OML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 14)no clan defined DUF6317; Family of unknown function (DUF6317) (PF19840; HMM-score: 13.6)and 19 moreDUF4763; Domain of unknown function (DUF4763) (PF15960; HMM-score: 13.5)YabA; Initiation control protein YabA (PF06156; HMM-score: 13.2)EsxAB (CL0352) Hydro_N_hd; Hydrolase N-terminal helical domain (PF22905; HMM-score: 13)DUF5344; Family of unknown function (DUF5344) (PF17279; HMM-score: 12.9)no clan defined DUF1664; Protein of unknown function (DUF1664) (PF07889; HMM-score: 12.3)LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.7)no clan defined MRPL52; Mitoribosomal protein mL52 (PF18699; HMM-score: 10.8)LemA; LemA family (PF04011; HMM-score: 10)PoNi_N; PoNe immunity protein (PoNi), N-terminal (PF08928; HMM-score: 9.6)Uso1_p115_C; Uso1 / p115 like vesicle tethering protein, C terminal region (PF04871; HMM-score: 9.2)FlaC_arch; Flagella accessory protein C (FlaC) (PF05377; HMM-score: 8.6)APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 8.3)Cnn_1N; Centrosomin N-terminal motif 1 (PF07989; HMM-score: 8.1)Ax_dynein_light; Axonemal dynein light chain (PF10211; HMM-score: 7.9)bZIP (CL0018) bZIP_1; bZIP transcription factor (PF00170; HMM-score: 7.4)MazG (CL0231) Nuf2_DHR10-like; Nuf2, DHR10-like domain (PF18595; HMM-score: 7.4)no clan defined GrpE; GrpE (PF01025; HMM-score: 7.3)RPW8; Arabidopsis broad-spectrum mildew resistance protein RPW8 (PF05659; HMM-score: 6.9)Prominin; Prominin (PF05478; HMM-score: 4.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.6328
- Cell wall & surface Score: 0.0317
- Extracellular Score: 0.3354
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: 0
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: LLAGCGS
- SignalP: Signal peptide LIPO(Sec/SPII) length 16 aa
- SP(Sec/SPI): 0.000578
- TAT(Tat/SPI): 0.000055
- LIPO(Sec/SPII): 0.999143
- Cleavage Site: CS pos: 16-17. LAG-CG. Pr: 0.9997
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKKLVSIVGATLLLAGCGSQNLAPLEEKTTDLREDNHQLKLDIQELNQQISDSKSKIKGLEKDKENSKKTASNNTKIKLMNVTSTYYDKVAKALKSYNDIEKDVSKNKGDKNVQSKLNQISNDIQSAHTSYKDAIDGLSLSDDDKKTSKNIDKLNSDLNHAFDDIKNGYQNKDKKQLTKGQQALSKLNLNAKS
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.