From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01668
  • pan locus tag?: SAUPAN004148000
  • symbol: era
  • pan gene symbol?: era
  • synonym:
  • product: GTP-binding protein Era

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01668
  • symbol: era
  • product: GTP-binding protein Era
  • replicon: chromosome
  • strand: -
  • coordinates: 1581790..1582689
  • length: 900
  • essential: yes [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGACAGAACATAAATCAGGATTTGTTTCAATTATAGGTAGACCAAATGTAGGAAAGTCA
    ACATTTGTTAATAGAGTGATCGGCCATAAAATAGCAATCATGTCCGATAAAGCTCAAACA
    ACTAGAAATAAAATTCAAGGTGTTATGACAAGAGATGACGCGCAAATTATATTCATTGAT
    ACGCCAGGTATTCATAAACCTAAACACAAATTAGGTGACTATATGATGAAAGTCGCTAAA
    AATACATTATCTGAGATAGATGCAATCATGTTTATGGTTAATGCCAATGAGGAAATTGGA
    CGAGGCGATGAATATATTATAGAAATGTTGAAAAATGTTAAGACACCAGTATTTTTAGTA
    TTAAATAAAATAGATTTAGTGCATCCAGATGAATTAATGCCAAAGATTGAAGAATATCAA
    AGTTATATGGACTTTACAGAGATTGTACCTATTTCAGCATTAGAAGGGCTAAATGTCGAT
    CATTTTATTGATGTTTTAAAGACGTATTTACCCGAAGGACCTAAATATTATCCAGATGAT
    CAAATTTCAGACCATCCTGAACAATTTGTAGTGGGTGAAATCATTCGTGAAAAAATCCTT
    CATCTTACAAGTGAAGAAATCCCTCATGCGATTGGTGTTAATGTGGACCGTATGGTTAAA
    GAAAGCGAAGATCGTGTTCATATCGAAGCAACTATATATGTTGAAAGAGGTTCGCAAAAA
    GGAATTGTCATTGGAAAAGGCGGTAAAAAGTTAAAAGAAGTAGGAAAACGTGCGAGACGT
    GATATAGAAATGCTTCTAGGCTCTAAAGTTTACTTAGAATTATGGGTCAAAGTTCAAAGA
    GACTGGCGAAACAAAGTTAACTTTATTCGCCAAATTGGTTATGTTGAAGACCAAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_01668
  • symbol: Era
  • description: GTP-binding protein Era
  • length: 299
  • theoretical pI: 6.69067
  • theoretical MW: 34270.4
  • GRAVY: -0.343478

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 350.3)
    and 18 more
    Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 133.5)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 96.3)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 79.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 71.3)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 57.9)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 54.2)
    Genetic information processing Protein synthesis Other Obg family GTPase CgtA (TIGR02729; HMM-score: 41.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 41.1)
    Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 40)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 37.4)
    Genetic information processing Protein synthesis Translation factors translation initiation factor IF-2 (TIGR00487; HMM-score: 35.2)
    translation initiation factor 2, gamma subunit (TIGR03680; HMM-score: 34.1)
    Metabolism Transport and binding proteins Nucleosides, purines and pyrimidines GTP-binding protein (TIGR00991; HMM-score: 20.7)
    Genetic information processing Protein synthesis Translation factors translation initiation factor aIF-2 (TIGR00491; HMM-score: 18.5)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines chloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 15.4)
    nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 13.5)
    Genetic information processing Protein synthesis Translation factors peptide chain release factor 3 (TIGR00503; HMM-score: 13.4)
  • TheSEED  :
    • GTP-binding protein Era
    Protein Metabolism Protein biosynthesis Universal GTPases  GTP-binding protein Era
    and 1 more
    RNA Metabolism RNA processing and modification tRNA modification Archaea  GTP-binding protein Era
  • PFAM:
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 86.7)
    KH (CL0007) KH_2; KH domain (PF07650; HMM-score: 79.3)
    and 15 more
    P-loop_NTPase (CL0023) FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 50.1)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 47.9)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 45.2)
    AIG1; AIG1 family (PF04548; HMM-score: 32.3)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 29.5)
    PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 23.4)
    cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 22)
    no clan defined MMR_HSR1_Xtn; C-terminal region of MMR_HSR1 domain (PF16897; HMM-score: 19.9)
    P-loop_NTPase (CL0023) Ras; Ras family (PF00071; HMM-score: 19.3)
    Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 16.7)
    Gtr1_RagA; Gtr1/RagA G protein conserved region (PF04670; HMM-score: 14.3)
    ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 14)
    MMR_HSR1_C; GTPase of unknown function C-terminal (PF08438; HMM-score: 13.2)
    KH (CL0007) KH_4; KH domain (PF13083; HMM-score: 12.9)
    P-loop_NTPase (CL0023) AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 12.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003811
    • TAT(Tat/SPI): 0.00048
    • LIPO(Sec/SPII): 0.000587
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFIDTPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLVLNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDDQISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERGSQKGIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. ↑ 4.0 4.1 4.2 4.3 4.4 4.5 4.6 4.7 4.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  5. ↑ 5.0 5.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_01668&oldid=84579"