Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1624 [new locus tag: SACOL_RS08280 ]
- pan locus tag?: SAUPAN004148000
- symbol: era
- pan gene symbol?: era
- synonym:
- product: GTP-binding protein Era
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1624 [new locus tag: SACOL_RS08280 ]
- symbol: era
- product: GTP-binding protein Era
- replicon: chromosome
- strand: -
- coordinates: 1655751..1656650
- length: 900
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238299 NCBI
- RefSeq: YP_186464 NCBI
- BioCyc: see SACOL_RS08280
- MicrobesOnline: 913073 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661
721
781
841ATGACAGAACATAAATCAGGATTTGTTTCAATTATAGGTAGACCAAATGTAGGAAAGTCA
ACATTTGTTAATAGAGTGATCGGCCATAAAATAGCAATCATGTCCGATAAAGCTCAAACA
ACTAGAAATAAAATTCAAGGTGTTATGACAAGAGATGACGCGCAAATTATATTCATTGAT
ACGCCAGGTATTCATAAACCTAAACACAAATTAGGTGACTATATGATGAAAGTCGCTAAA
AATACATTATCTGAGATAGATGCAATCATGTTTATGGTTAATGCCAATGAGGAAATTGGA
CGAGGCGATGAATATATTATAGAAATGTTGAAAAATGTTAAGACACCAGTATTTTTAGTA
TTAAATAAAATAGATTTAGTGCATCCAGATGAATTAATGCCAAAGATTGAAGAATATCAA
AGTTATATGGACTTTACAGAGATTGTACCTATTTCAGCATTAGAAGGGCTAAATGTCGAT
CATTTTATTGATGTTTTAAAGACGTATTTACCCGAAGGACCTAAATATTATCCAGATGAT
CAAATTTCAGACCATCCTGAACAATTTGTAGTGGGTGAAATCATTCGTGAAAAAATCCTT
CATCTTACAAGTGAAGAAATCCCTCATGCGATTGGTGTTAATGTGGACCGTATGGTTAAA
GAAAGCGAAGATCGTGTTCATATCGAAGCAACTATATATGTTGAAAGAGATTCGCAAAAA
GGAATTGTCATTGGAAAAGGCGGTAAAAAGTTAAAAGAAGTAGGAAAACGTGCGAGACGT
GATATAGAAATGCTTCTAGGCTCTAAAGTTTACTTAGAATTATGGGTCAAAGTTCAAAGA
GACTGGCGAAACAAAGTTAACTTTATTCGCCAAATTGGTTATGTTGAAGACCAAGATTAA60
120
180
240
300
360
420
480
540
600
660
720
780
840
900
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1624 [new locus tag: SACOL_RS08280 ]
- symbol: Era
- description: GTP-binding protein Era
- length: 299
- theoretical pI: 6.5234
- theoretical MW: 34328.5
- GRAVY: -0.353846
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 351)and 18 moreProtein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 133.5)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 96.4)Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 79.4)Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 71.4)Protein synthesis Other ribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 57.9)Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 54.3)Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 41.5)Protein synthesis Other Obg family GTPase CgtA (TIGR02729; HMM-score: 41.2)Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 40.1)Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 37.5)Protein synthesis Translation factors translation initiation factor IF-2 (TIGR00487; HMM-score: 35.1)translation initiation factor 2, gamma subunit (TIGR03680; HMM-score: 34.2)Transport and binding proteins Nucleosides, purines and pyrimidines GTP-binding protein (TIGR00991; HMM-score: 20.7)Protein synthesis Translation factors translation initiation factor aIF-2 (TIGR00491; HMM-score: 19.8)Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.3)Transport and binding proteins Amino acids, peptides and amines chloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 15.1)nicotinamide-nucleotide adenylyltransferase (TIGR01526; EC 2.7.7.1; HMM-score: 13.5)Protein synthesis Translation factors peptide chain release factor 3 (TIGR00503; HMM-score: 13.4)
- TheSEED :
- GTP-binding protein Era
and 1 more - PFAM: P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 95.3)KH (CL0007) KH_2; KH domain (PF07650; HMM-score: 81.6)and 16 moreP-loop_NTPase (CL0023) GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 53.8)FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 49.6)Dynamin_N; Dynamin family (PF00350; HMM-score: 44.1)AIG1; AIG1 family (PF04548; HMM-score: 31.5)RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 29.6)cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 21.8)PduV-EutP; Ethanolamine utilisation - propanediol utilisation (PF10662; HMM-score: 21.8)no clan defined MMR_HSR1_Xtn; C-terminal region of MMR_HSR1 domain (PF16897; HMM-score: 20.5)P-loop_NTPase (CL0023) Ras; Ras family (PF00071; HMM-score: 19.1)Roc; Ras of Complex, Roc, domain of DAPkinase (PF08477; HMM-score: 17.9)AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 15.4)ATP_bind_1; Conserved hypothetical ATP binding protein (PF03029; HMM-score: 14.4)nSTAND3; Novel STAND NTPase 3 (PF20720; HMM-score: 12.9)SpoIVA_ATPase; Stage IV sporulation protein A, ATPase domain (PF09547; HMM-score: 12.5)AAA_22; AAA domain (PF13401; HMM-score: 12.4)KH (CL0007) KH_KhpA-B; KhpA/KhpB, KH domain (PF13083; HMM-score: 12.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 1.05
- Cytoplasmic Membrane Score: 8.78
- Cellwall Score: 0.08
- Extracellular Score: 0.09
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9833
- Cytoplasmic Membrane Score: 0.0127
- Cell wall & surface Score: 0
- Extracellular Score: 0.0039
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003811
- TAT(Tat/SPI): 0.00048
- LIPO(Sec/SPII): 0.000587
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTEHKSGFVSIIGRPNVGKSTFVNRVIGHKIAIMSDKAQTTRNKIQGVMTRDDAQIIFIDTPGIHKPKHKLGDYMMKVAKNTLSEIDAIMFMVNANEEIGRGDEYIIEMLKNVKTPVFLVLNKIDLVHPDELMPKIEEYQSYMDFTEIVPISALEGLNVDHFIDVLKTYLPEGPKYYPDDQISDHPEQFVVGEIIREKILHLTSEEIPHAIGVNVDRMVKESEDRVHIEATIYVERDSQKGIVIGKGGKKLKEVGKRARRDIEMLLGSKVYLELWVKVQRDWRNKVNFIRQIGYVEDQD
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 251 [4]
- interaction partners:
SACOL1782 (fhs) formate--tetrahydrofolate ligase [5] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [5] (data from MRSA252) SACOL1206 (ileS) isoleucyl-tRNA synthetase [5] (data from MRSA252) SACOL1285 (nusA) transcription elongation factor NusA [5] (data from MRSA252) SACOL1091 (ptsH) phosphocarrier protein HPr [5] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [5] (data from MRSA252) SACOL2233 (rpsC) 30S ribosomal protein S3 [5] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [5] (data from MRSA252) SACOL0832 hypothetical protein [5] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: 11.17 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 5.0 5.1 5.2 5.3 5.4 5.5 5.6 5.7 5.8 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
