From AureoWiki
Revision as of 09:58, 10 March 2016 by AureoSysAdmin (talk | contribs) (Text replacement - "* <aureodatabase>protein Genbank</aureodatabase> " to "")
(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)
Jump to navigation Jump to search

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0225 [new locus tag: NWMN_RS01255 ]
  • symbol: NWMN_0225
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 286233..286547
  • length: 315
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTGGATATAAAGGTATTAAAGCAGATGGTGGCAAGGTTGATCAAGCGAAACAATTA
    GCGGCAAAAACAGCTAAAGATATTGAAGCATGTCAAAAGCAAACGCAACAGCTCGCTGAG
    TATATCGAAGGTAGTGATTGGGAAGGACAGTTCGCCAATAAGGTGAAAGATGTGTTACTC
    ATTATGGCAAAGTTTCAAGAAGAATTAGTACAACCGATGGCTGACCATCAAAAAGCAATT
    GATAACTTAAGTCAAAATCTAGCGAAATACGATACATTATCAATTAAGCAAGGGCTTGAT
    AGGGTGAACCCATGA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0225 [new locus tag: NWMN_RS01255 ]
  • symbol: NWMN_0225
  • description: hypothetical protein
  • length: 104
  • theoretical pI: 5.87793
  • theoretical MW: 11510
  • GRAVY: -0.625

Function[edit | edit source]

  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 20.8)
    and 1 more
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 13.5)
  • TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 47.8)
    and 7 more
    no clan defined YfdX; YfdX protein (PF10938; HMM-score: 14.8)
    KNOX2; KNOX2 domain (PF03791; HMM-score: 14.7)
    Tox-REase-2; Restriction endonuclease fold toxin 2 (PF15646; HMM-score: 14.6)
    DivIVA; DivIVA protein (PF05103; HMM-score: 13.9)
    DUF4298; Domain of unknown function (DUF4298) (PF14131; HMM-score: 13.9)
    SlyX; SlyX (PF04102; HMM-score: 12.9)
    HTH (CL0123) EAP30; EAP30/Vps36 family (PF04157; HMM-score: 11.6)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 9.98
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009569
    • TAT(Tat/SPI): 0.000406
    • LIPO(Sec/SPII): 0.020639
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGGYKGIKADGGKVDQAKQLAAKTAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP

Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]