From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0278 [new locus tag: SA_RS01625 ]
  • pan locus tag?: SAUPAN001186000
  • symbol: SA0278
  • pan gene symbol?: esxB
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0278 [new locus tag: SA_RS01625 ]
  • symbol: SA0278
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 337396..337710
  • length: 315
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGGGTGGATATAAAGGGATTAAAGCAGATGGTGGCAAGGTGAATCAAGCGAAACAATTA
    GCGGCAAAAATAGCTAAAGATATTGAAGCATGTCAAAAGCAAACGCAACAGCTCGCTGAG
    TATATCGAAGGTAGTGATTGGGAAGGACAGTTCGCCAATAAGGTGAAAGATGTGTTACTT
    ATTATGGCAAAGTTTCAAGAAGAATTAGTACAACCGATGGCTGACCATCAAAAAGCAATT
    GATAACTTAAGTCAAAATCTAGCGAAATACGATACATTATCAATTAAGCAAGGACTTGAT
    AGGGTGAACCCATGA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0278 [new locus tag: SA_RS01625 ]
  • symbol: SA0278
  • description: hypothetical protein
  • length: 104
  • theoretical pI: 7.35157
  • theoretical MW: 11521.1
  • GRAVY: -0.575

Function[edit | edit source]

  • TIGRFAM:
    WXG100 family type VII secretion target (TIGR03930; HMM-score: 18.2)
    and 1 more
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 14.4)
  • TheSEED  :
    • 10 kDa culture filtrate antigen CFP-10 (EsxB)
    Membrane Transport Protein secretion system, Type VII ESAT-6 proteins secretion system in Firmicutes  10 kDa culture filtrate antigen CFP-10 (EsxB)
  • PFAM:
    EsxAB (CL0352) WXG100; Proteins of 100 residues with WXG (PF06013; HMM-score: 48.9)
    and 10 more
    P-loop_NTPase (CL0023) ADDB_N; ADDB, N-terminal (PF21445; HMM-score: 22.6)
    no clan defined Baculo_PEP_C; Baculovirus polyhedron envelope protein, PEP, C terminus (PF04513; HMM-score: 16.9)
    DUF4298; Domain of unknown function (DUF4298) (PF14131; HMM-score: 16.4)
    DivIVA; DivIVA protein (PF05103; HMM-score: 15.9)
    Alpha_Helical; Alpha helical domain (PF18489; HMM-score: 13.3)
    KNOX2; KNOX2 domain (PF03791; HMM-score: 13.2)
    RecG_N; RecG N-terminal helical domain (PF17190; HMM-score: 13.1)
    FlaX; FlaX (PF24151; HMM-score: 13.1)
    6PGD_C (CL0106) PDH_C; Prephenate dehydrogenase, dimerization domain (PF20463; HMM-score: 12.4)
    no clan defined Nsp1_C; Nsp1-like C-terminal region (PF05064; HMM-score: 11.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 10
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0006
    • Cytoplasmic Membrane Score: 0.0016
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.9977
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.008968
    • TAT(Tat/SPI): 0.000341
    • LIPO(Sec/SPII): 0.029163
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MGGYKGIKADGGKVNQAKQLAAKIAKDIEACQKQTQQLAEYIEGSDWEGQFANKVKDVLLIMAKFQEELVQPMADHQKAIDNLSQNLAKYDTLSIKQGLDRVNP

Experimental data[edit | edit source]

  • experimentally validated: data available for COL
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]