From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0040 [new locus tag: NWMN_RS00240 ]
  • pan locus tag?: SAUPAN000853000
  • symbol: NWMN_0040
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0040 [new locus tag: NWMN_RS00240 ]
  • symbol: NWMN_0040
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 53567..54049
  • length: 483
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGAGAAATTTAACAACTGGATATTAAATGCAATAAGTGGATCTCAAACAGACAAGAAT
    GAAACAACTGAAGAATTAAAAGGGGCAAAATTTATCATTTTATATGCATATTCAATGCTC
    GTTTTGCTTGCGTTAGTAATTTCTAACATATTCATTCACATTTTGGAGCCTAAACTATCA
    ATCACCACTCAAATCATCATCGTTTTGATTTTAATTGAAGCACTAATTGGACTGCGTTTC
    TTGAAAGCGTACGATGTTAAGCGTGGCAAAGATAAAGAAAATAAGAAAAATAGTAAGGAT
    TTCGTTAAACTAAAATCAATTTTAGTAGCAATTTTATTTACATCATTGGCGCTGACAGCA
    GGTACTGTAGCTGATATATACGGTTTCACTGACTTAGGAAATACTAGAAGTGATTTAATC
    GTTTGGAGCATAGGTGGTATTATATTTGGCCTCGTATGTTACACAATGGAAGATAAAAGA
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    483

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0040 [new locus tag: NWMN_RS00240 ]
  • symbol: NWMN_0040
  • description: hypothetical protein
  • length: 160
  • theoretical pI: 9.35138
  • theoretical MW: 17920.1
  • GRAVY: 0.429375

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesoligosaccharide repeat unit polymerase (TIGR04370; HMM-score: 16.8)
  • TheSEED:  
    FIG01108341: hypothetical protein 
  • PFAM:
    no clan definedDUF1980; Domain of unknown function (DUF1980) (PF09323; HMM-score: 17.8)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 14)
    no clan definedCD34_antigen; CD34/Podocalyxin family (PF06365; HMM-score: 10)
    DUF983; Protein of unknown function (DUF983) (PF06170; HMM-score: 8.7)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 7.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 4
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.099
    • Ymax_pos: 21
    • Cmax: 0.119
    • Cmax_pos: 61
    • Smax: 0.115
    • Smax_pos: 20
    • Smean: 0.072
    • D: 0.088
  • predicted transmembrane helices (TMHMM): 4

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEKFNNWILNAISGSQTDKNETTEELKGAKFIILYAYSMLVLLALVISNIFIHILEPKLSITTQIIIVLILIEALIGLRFLKAYDVKRGKDKENKKNSKDFVKLKSILVAILFTSLALTAGTVADIYGFTDLGNTRSDLIVWSIGGIIFGLVCYTMEDKR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]