From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0071 [new locus tag: NWMN_RS00400 ]
  • pan locus tag?: SAUPAN000932000
  • symbol: NWMN_0071
  • pan gene symbol?: butA
  • synonym:
  • product: acetoin reductase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0071 [new locus tag: NWMN_RS00400 ]
  • symbol: NWMN_0071
  • product: acetoin reductase
  • replicon: chromosome
  • strand: +
  • coordinates: 92433..93209
  • length: 777
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACAAACAACAAAGTAGCATTAGTAACTGGCGGAGCACAAGGGATTGGTTTTAAAATT
    GCAGAACGTTTAGTGGAAGATGGTTTCAAAGTAGCAGTTGTTGATTTCAATGAAGAAGGG
    GCAAAAGCAGCTGCACTTAAATTATCAAGTGATGGTACAAAAGCTATTGCTATCAAAGCA
    GATGTATCAAACCGTGATGATGTATTTAACGCAGTAAGACAAACTGCCGCGCAATTTGGC
    GATTTCCATGTCATGGTTAACAATGCCGGCCTTGGACCAACAACACCAATCGATACAATT
    ACTGAAGAACAGTTTAAAACAGTATATGGCGTGAACGTTGCAGGTGTGCTATGGGGTATT
    CAAGCCGCACATGAACAATTTAAAAAATTCAATCATGGCGGTAAAATTATCAATGCAACA
    TCTCAAGCAGGCGTTGAGGGTAACCCAGGCTTGTCTTTATATTGCAGTACAAAATTCGCA
    GTGCGAGGTTTAACACAAGTAGCCGCACAAGATTTAGCGTCTGAAGGTATTACTGTGAAT
    GCATTCGCACCTGGTATCGTTCAAACACCAATGATGGAAAGTATCGCAGTGGCAACAGCC
    GAAGAAGCAGGTAAACCTGAAGCATGGGGTTGGGAACAATTTACAAGTCAGATTGCTTTG
    GGCAGAGTTTCTCAACCAGAAGATGTTTCAAATGTAGTGAGCTTCTTAGCTGGTAAAGAC
    TCTGATTACATTACTGGACAAACAATTATTGTAGATGGTGGTATGAGATTCCGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    777

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0071 [new locus tag: NWMN_RS00400 ]
  • symbol: NWMN_0071
  • description: acetoin reductase
  • length: 258
  • theoretical pI: 4.79367
  • theoretical MW: 27215.5
  • GRAVY: -0.0108527

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismEnergy metabolismFermentationacetoin reductases (TIGR02415; EC 1.1.1.-; HMM-score: 418.5)
    MetabolismFatty acid and phospholipid metabolismBiosynthesis3-oxoacyl-[acyl-carrier-protein] reductase (TIGR01830; EC 1.1.1.100; HMM-score: 190.3)
    3-hydroxybutyrate dehydrogenase (TIGR01963; HMM-score: 184.5)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR03971; EC 1.1.99.-; HMM-score: 170.7)
    acetoacetyl-CoA reductase (TIGR01829; EC 1.1.1.36; HMM-score: 155.2)
    2-hydroxycyclohexanecarboxyl-CoA dehydrogenase (TIGR03206; EC 1.1.1.-; HMM-score: 153.3)
    2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase (TIGR04316; EC 1.3.1.28; HMM-score: 151.9)
    Unknown functionEnzymes of unknown specificitySDR family mycofactocin-dependent oxidoreductase (TIGR04504; EC 1.1.99.-; HMM-score: 132.1)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharides2-deoxy-D-gluconate 3-dehydrogenase (TIGR01832; EC 1.1.1.125; HMM-score: 128.7)
    rhamnulose-1-phosphate aldolase/alcohol dehydrogenase (TIGR02632; EC 1.1.1.1,4.1.2.19; HMM-score: 128.2)
    MetabolismFatty acid and phospholipid metabolismBiosynthesisputative 3-oxoacyl-(acyl-carrier-protein) reductase (TIGR01831; HMM-score: 127.3)
    cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase (TIGR03325; EC 1.3.1.56; HMM-score: 101.2)
    pteridine reductase (TIGR02685; EC 1.5.1.33; HMM-score: 92.3)
    sepiapterin reductase (TIGR01500; EC 1.1.1.153; HMM-score: 42.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersChlorophyll and bacteriochlorphylllight-dependent protochlorophyllide reductase (TIGR01289; EC 1.3.1.33; HMM-score: 18.5)
    polyketide-type polyunsaturated fatty acid synthase PfaA (TIGR02813; HMM-score: 16.8)
    MetabolismEnergy metabolismSugarsUDP-glucose 4-epimerase GalE (TIGR01179; EC 5.1.3.2; HMM-score: 16)
    NAD dependent epimerase/dehydratase, LLPSF_EDH_00030 family (TIGR04180; HMM-score: 14.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdTDP-glucose 4,6-dehydratase (TIGR01181; EC 4.2.1.46; HMM-score: 14.1)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesADP-glyceromanno-heptose 6-epimerase (TIGR02197; EC 5.1.3.20; HMM-score: 12.1)
  • TheSEED:  
    Acetoin, butanediol metabolism 2,3-butanediol dehydrogenase, S-alcohol forming, (R)-acetoin-specific (EC 1.1.1.4) / Acetoin (diacetyl) reductase (EC 1.1.1.304) 
  • PFAM:
    NADP_Rossmann (CL0063) adh_short_C2; Enoyl-(Acyl carrier protein) reductase (PF13561; HMM-score: 196.9)
    adh_short; short chain dehydrogenase (PF00106; HMM-score: 187.2)
    KR; KR domain (PF08659; HMM-score: 56)
    3Beta_HSD; 3-beta hydroxysteroid dehydrogenase/isomerase family (PF01073; HMM-score: 16.8)
    Sacchrp_dh_NADP; Saccharopine dehydrogenase NADP binding domain (PF03435; HMM-score: 16.4)
    TrkA_N; TrkA-N domain (PF02254; HMM-score: 15.7)
    3HCDH_N; 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain (PF02737; HMM-score: 15.1)
    Epimerase; NAD dependent epimerase/dehydratase family (PF01370; HMM-score: 15)
    Ubie_methyltran; ubiE/COQ5 methyltransferase family (PF01209; HMM-score: 14.7)
    no clan definedDynein_attach_N; Dynein attachment factor N-terminus (PF15867; HMM-score: 14.6)
    Pec_lyase-like (CL0268) Pertactin; Pertactin (PF03212; HMM-score: 12.6)
    NADP_Rossmann (CL0063) GDP_Man_Dehyd; GDP-mannose 4,6 dehydratase (PF16363; HMM-score: 11.6)
    NmrA; NmrA-like family (PF05368; HMM-score: 10.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.129
    • Ymax_pos: 11
    • Cmax: 0.145
    • Cmax_pos: 44
    • Smax: 0.253
    • Smax_pos: 1
    • Smean: 0.144
    • D: 0.134
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNNKVALVTGGAQGIGFKIAERLVEDGFKVAVVDFNEEGAKAAALKLSSDGTKAIAIKADVSNRDDVFNAVRQTAAQFGDFHVMVNNAGLGPTTPIDTITEEQFKTVYGVNVAGVLWGIQAAHEQFKKFNHGGKIINATSQAGVEGNPGLSLYCSTKFAVRGLTQVAAQDLASEGITVNAFAPGIVQTPMMESIAVATAEEAGKPEAWGWEQFTSQIALGRVSQPEDVSNVVSFLAGKDSDYITGQTIIVDGGMRFR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CodY
    CodY (TF) important in Amino acid metabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]