From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0159 [new locus tag: NWMN_RS00870 ]
  • pan locus tag?: SAUPAN001076000
  • symbol: NWMN_0159
  • pan gene symbol?: hptR
  • synonym:
  • product: DNA-binding response regulator AraC family protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0159 [new locus tag: NWMN_RS00870 ]
  • symbol: NWMN_0159
  • product: DNA-binding response regulator AraC family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 202025..202783
  • length: 759
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTTTAAGGTAGTTATTTGTGATGATGAACGAATTATTCGAGAAGGATTAAAGCAAATC
    ATTCCTTGGGGAGACTATCATTTCAATACAATATACACTGCTAAAGATGGTGTTGAAGCA
    TTATCACTAATTCAACAACATCAGCCAGAATTAGTAATTACTGATATTCGTATGCCACGT
    AAAAATGGCGTCGATTTACTCAATGATATTGCGCATCTAGATTGTAATGTCATCATATTA
    TCGAGTTACGATGACTTTGAATATATGAAAGCCGGCATTCAACATCATGTTCTTGATTAT
    TTATTAAAACCAGTAGACCATGCACAATTAGAAGTTATTTTAGGAAGACTTGTCCGTACC
    TTATTAGAGCAACAATCACAGAACGGCCGTAGCTTAGCATCTTGTCATGATGCCTTCCAA
    CCACTATTAAAAGTAGAATACGATGATTATTATGTAAACCAGATTGTGGATCAAATTAAG
    CAATCTTATCAAACGAAAGTGACTGTTTCAGATTTAATTCAACATATCGATGTTAGTGAA
    TCGTATGCGATGCGAACATTTAAAGATCATGTTGGTATTACAATTGTCGATTATTTAAAT
    CGCTATCGTATTTTACAATCTCTGCAATTGTTAGATCGACATTACAAACACTATGAAATT
    GCAGACAAAGTAGGCTTTTCAGAGTATAAAATGTTTAGCTATCATTTTAAAAAATATTTA
    CAAATGTCGCCAAGTGATTATTGTAAGCAAGCAAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0159 [new locus tag: NWMN_RS00870 ]
  • symbol: NWMN_0159
  • description: DNA-binding response regulator AraC family protein
  • length: 252
  • theoretical pI: 6.50679
  • theoretical MW: 29598.7
  • GRAVY: -0.317063

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    YSIRK-targeted surface antigen transcriptional regulator (TIGR04094; HMM-score: 61.7)
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 56.2)
    Signal transductionRegulatory functionsDNA interactionsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 56.2)
    Signal transductionSignal transductionTwo-component systemsnitrogen regulation protein NR(I) (TIGR01818; HMM-score: 56.2)
    Cellular processesCellular processesSporulation and germinationsporulation transcription factor Spo0A (TIGR02875; HMM-score: 52.9)
    Signal transductionRegulatory functionsDNA interactionsheavy metal response regulator (TIGR01387; HMM-score: 39.5)
    Signal transductionRegulatory functionsDNA interactionsPEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 36.3)
    Signal transductionRegulatory functionsDNA interactionsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 30.6)
    Signal transductionSignal transductionTwo-component systemsphosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 30.6)
    Signal transductionSignal transductionTwo-component systemsTMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 20.5)
    4-hydroxyphenylacetate catabolism regulatory protein HpaA (TIGR02297; HMM-score: 15.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMenaquinone and ubiquinone3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 13.1)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 12.5)
  • TheSEED:  
    DNA-binding response regulator, AraC family 
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 86.8)
    HTH (CL0123) HTH_18; Helix-turn-helix domain (PF12833; HMM-score: 58.3)
    HTH_AraC; Bacterial regulatory helix-turn-helix proteins, AraC family (PF00165; HMM-score: 48)
    PEP-carboxyk (CL0374) Hpr_kinase_C; HPr Serine kinase C-terminal domain (PF07475; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.095
    • Ymax_pos: 70
    • Cmax: 0.12
    • Cmax_pos: 53
    • Smax: 0.1
    • Smax_pos: 57
    • Smean: 0.069
    • D: 0.085
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIAHLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRTLLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYLQMSPSDYCKQAK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Joo Youn Park, Jong Wan Kim, Bo Youn Moon, Juyeun Lee, Ye Ji Fortin, Frank W Austin, Soo-Jin Yang, Keun Seok Seo
Characterization of a novel two-component regulatory system, HptRS, the regulator for the hexose phosphate transport system in Staphylococcus aureus.
Infect. Immun.: 2015, 83(4);1620-8
[PubMed:25644013] [WorldCat.org] [DOI] (I p)