From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0210
  • pan locus tag?: SAUPAN001163000
  • symbol: lytM
  • pan gene symbol?: lytM
  • synonym:
  • product: peptidoglycan hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0210
  • symbol: lytM
  • product: peptidoglycan hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 267940..268680
  • length: 741
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTTTGATAATAAAGAATATAGCTATACATTCGTAGATGCTCAAGGACATACGCATTAT
    TTTTATAACTGTTATCCAAAAAATGCAAATGCCAATGGAAGCGGCCAAACATATGTGAAT
    CCAGCAACAGCAGGAGATAACAATGACTACACAGCGAGTCAAAGCCAACAGCATATTAAT
    CAATATGGTTATCAATCAAATGTAGGTCCAGACGCGAGCTATTATTCACATAGTAACAAC
    AACCAAGCGTATAACAGCCATGATGGTAATGGAAAGGTCAATTATCCTAATGGCACATCT
    AATCAAAATGGTGGATCAGCAAGTAAAGCGACAGCTAGTGGTCATGCGAAAGACGCAAGC
    TGGTTAACAAGTCGTAAACAACTACAACCATATGGACAATATCACGGTGGTGGTGCGCAT
    TACGGTGTCGACTATGCAATGCCTGAAAATTCACCAGTTTACTCATTAACTGATGGTACA
    GTAGTACAAGCAGGTTGGAGTAACTATGGTGGCGGCAATCAAGTAACGATTAAAGAAGCG
    AACAGTAATAACTACCAATGGTATATGCATAATAATCGTTTAACTGTTTCAGCTGGTGAT
    AAAGTCAAAGCTGGTGACCAAATTGCATATTCAGGTAGTACGGGTAATTCAACAGCGCCT
    CACGTACACTTCCAACGTATGTCTGGTGGCATCGGTAATCAATATGCAGTAGACCCAACG
    TCATACTTGCAAAGTAGATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    741

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0210
  • symbol: LytM
  • description: peptidoglycan hydrolase
  • length: 246
  • theoretical pI: 7.12946
  • theoretical MW: 26688.1
  • GRAVY: -1.0061

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionDNA-dependent RNA polymeraseDNA-directed RNA polymerase, beta' subunit (TIGR02386; EC 2.7.7.6; HMM-score: 11.7)
  • TheSEED:  
    Protein MetabolismProtein degradationEC 3.4.24.- Metalloendopeptidases Glycyl-glycine endopeptidase LytM precursor (EC 3.4.24.75) 
  • PFAM:
    Hybrid (CL0105) Peptidase_M23; Peptidase family M23 (PF01551; HMM-score: 96)
    no clan definedDUF4124; Domain of unknown function (DUF4124) (PF13511; HMM-score: 13)
    RNase_H (CL0219) DNA_pol_B_exo1; DNA polymerase family B, exonuclease domain (PF03104; HMM-score: 9.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.179
    • Ymax_pos: 32
    • Cmax: 0.175
    • Cmax_pos: 32
    • Smax: 0.237
    • Smax_pos: 31
    • Smean: 0.141
    • D: 0.164
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFDNKEYSYTFVDAQGHTHYFYNCYPKNANANGSGQTYVNPATAGDNNDYTASQSQQHINQYGYQSNVGPDASYYSHSNNNQAYNSHDGNGKVNYPNGTSNQNGGSASKATASGHAKDASWLTSRKQLQPYGQYHGGGAHYGVDYAMPENSPVYSLTDGTVVQAGWSNYGGGNQVTIKEANSNNYQWYMHNNRLTVSAGDKVKAGDQIAYSGSTGNSTAPHVHFQRMSGGIGNQYAVDPTSYLQSR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]