From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0246 [new locus tag: NWMN_RS01360 ]
  • pan locus tag?: SAUPAN001222000
  • symbol: NWMN_0246
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0246 [new locus tag: NWMN_RS01360 ]
  • symbol: NWMN_0246
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 300231..300629
  • length: 399
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGAAAAATCGATCAAAATAATGACAATAATAGGAATTGTTGTTCAGGGTTTAGCAACG
    GTATTTAGTTTACTATTGATGGTTTTAGCAGCATCAGGTGTAATGACTACAGATGTGTCA
    ACAACAGTTAATGGTGAGGTTGACCCAGTTGATGCAGAAACAGCAGCAGCAATTTTCACT
    GTATTATTCTTATCCCTATTCATATTTGGAATCATTTCAATTATTTTAGGTGCAATCGGT
    ATGTTTAAAGCATCTAAAAACAAAAAAATGAGTGGTATATTGTTGATTATTGGAGCTGTA
    ATAAGTGGTAACATAATTACATTTGCTTTATGGTTAATCAGTGGTATTAAACTACTTACT
    AATAACAAGCCTAAAGATGAAATAAGCGACTTATCATAA
    60
    120
    180
    240
    300
    360
    399

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0246 [new locus tag: NWMN_RS01360 ]
  • symbol: NWMN_0246
  • description: hypothetical protein
  • length: 132
  • theoretical pI: 6.77736
  • theoretical MW: 13902.7
  • GRAVY: 1.05758

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Arginine Biosynthesis extended hypothetical protein 
  • PFAM:
    Tetraspannin (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 63.1)
    Yip1 (CL0112) DUF1129; Protein of unknown function (DUF1129) (PF06570; HMM-score: 21.6)
    NfeD-like (CL0252) NfeD; NfeD-like C-terminal, partner-binding (PF01957; HMM-score: 18.3)
    Tetraspannin (CL0347) Tetraspannin; Tetraspanin family (PF00335; HMM-score: 14.6)
    Yip1 (CL0112) DUF1282; Protein of unknown function (DUF1282) (PF06930; HMM-score: 11)
    no clan definedDUF2976; Protein of unknown function (DUF2976) (PF11190; HMM-score: 10.5)
    Myelin_PLP; Myelin proteolipid protein (PLP or lipophilin) (PF01275; HMM-score: 9)
    CopD_like (CL0430) DUF4149; Domain of unknown function (DUF4149) (PF13664; HMM-score: 7.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.306
    • Ymax_pos: 31
    • Cmax: 0.25
    • Cmax_pos: 31
    • Smax: 0.731
    • Smax_pos: 30
    • Smean: 0.313
    • D: 0.309
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEKSIKIMTIIGIVVQGLATVFSLLLMVLAASGVMTTDVSTTVNGEVDPVDAETAAAIFTVLFLSLFIFGIISIILGAIGMFKASKNKKMSGILLIIGAVISGNIITFALWLISGIKLLTNNKPKDEISDLS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]