From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0351 [new locus tag: NWMN_RS01990 ]
  • pan locus tag?: SAUPAN001903000
  • symbol: NWMN_0351
  • pan gene symbol?: metI
  • synonym:
  • product: Cys/Met metabolism PLP-dependent enzyme

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0351 [new locus tag: NWMN_RS01990 ]
  • symbol: NWMN_0351
  • product: Cys/Met metabolism PLP-dependent enzyme
  • replicon: chromosome
  • strand: -
  • coordinates: 402855..403958
  • length: 1104
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGAAGGATACACAGTTAGCCCAAATCACATTAACCGATGATTCAACCGGTGCTATAGCG
    AATCCAATCCATTTATCTACTGCCTACAAGCATCCAAAACTAGGACAATCGACAGGTTTT
    GATTATACACGTACTAAAAATCCTACACGCTCAACATTTGAAACCTGTTTTGCCAAACTT
    GAGCATGGTATTGCATCATTCGCTACATCAAGTGGAATGTCAGCCATTCAATTAATATGT
    AATCTATTTAAACCTCATGATGAAATTTTAGTTTCATTCGATTTATATGGTGGCACATTT
    AGATTATTTGAATTTTACGAGCAACAATACGATATCAAATTTAAGTACGTTGATTTTACA
    GATTATGAACAAGTTGAAAAAGAAATCACTGATAAAACAGTTGCATTATTCATTGAACCA
    ATATCTAACCCACAAATGATTGCTATTGATGTAAAGCCATACTATCAACTTTGTAAAGCT
    AAAGGCTTATTGTCAATTATCGACAATACTTTTTTAACACCTTATCTTTCAACACCACTA
    GCAGAAGGTGCTGATATAGTCTTACATTCAGCCACGAAATATATTGGCGGACATAACGAT
    GTACTAGCAGGTGTCGTAACCGTCAAAGATGAATCACTCGCGCAACAGTTGTTTGATTTT
    CACAACATGACTGGCGCAACACTTTCACCAATAGATAGTTATTTGTTGTTACGTGGACTT
    AAAACTTTGCATTTACGCATTGAGCGTGCGCAATCAAACGCTAGAAAACTTGCTAAAAAA
    TGTCAGTCACTTCAAGCAATTGACGAAGTACTATATAGCGGGCAAACTGGCATGCTTAGT
    TTAAGACTTAACAAGGCCTATAGCGTCGCTAAATTATTAGAAAATTTAGACATTTGCATT
    TTTGCAGAAAGTTTAGGAGGTACTGAAACATTAGTGACCTTCCCTTACACCCAAACACAT
    GTTGATATGCCAGATGCTGAAAAAGATAAACGTGGCATTGATGAGTATTTAATCCGCTTA
    TCACTAGGTGTTGAAAATTATGAAGACATCGAACGCGATATCATCCAAGCATTAGATAAA
    GCTCAGATTGGAGAGATTGTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1104

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0351 [new locus tag: NWMN_RS01990 ]
  • symbol: NWMN_0351
  • description: Cys/Met metabolism PLP-dependent enzyme
  • length: 367
  • theoretical pI: 5.01375
  • theoretical MW: 41071.6
  • GRAVY: -0.134332

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismAmino acid biosynthesisAspartate familyO-succinylhomoserine (thiol)-lyase (TIGR02080; EC 2.5.1.48; HMM-score: 312.8)
    MetabolismEnergy metabolismAmino acids and aminesmethionine gamma-lyase (TIGR01328; EC 4.4.1.11; HMM-score: 280.4)
    cystathionine beta-lyase (TIGR01329; EC 4.4.1.8; HMM-score: 277.7)
    MetabolismAmino acid biosynthesisAspartate familyO-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 241.8)
    MetabolismAmino acid biosynthesisSerine familyO-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 241.8)
    MetabolismAmino acid biosynthesisAspartate familyO-succinylhomoserine sulfhydrylase (TIGR01325; EC 4.2.99.-; HMM-score: 237.2)
    MetabolismAmino acid biosynthesisAspartate familycystathionine beta-lyase (TIGR01324; EC 4.4.1.8; HMM-score: 129.3)
    transaminase, acetylornithine/succinylornithine family (TIGR00707; HMM-score: 17.7)
    Unknown functionEnzymes of unknown specificitycysteine desulfurase family protein (TIGR01977; HMM-score: 17.7)
    Unknown functionEnzymes of unknown specificityuncharacterized pyridoxal phosphate-dependent enzyme (TIGR01437; HMM-score: 14.3)
    MetabolismEnergy metabolismAmino acids and aminessuccinylornithine transaminase family (TIGR03246; EC 2.6.1.81; HMM-score: 12.6)
  • TheSEED:  
    Amino Acids and DerivativesLysine, threonine, methionine, and cysteineMethionine Biosynthesis Cystathionine gamma-synthase (EC 2.5.1.48) 
    Sulfur MetabolismOrganic sulfur assimilationL-Cystine Uptake and Metabolism Cystathionine gamma-synthase (EC 2.5.1.48) 
  • PFAM:
    PLP_aminotran (CL0061) Cys_Met_Meta_PP; Cys/Met metabolism PLP-dependent enzyme (PF01053; HMM-score: 371.1)
    Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 24.6)
    Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 21.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:
    NWMN_1483(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    NWMN_0745(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    NWMN_0961(pdhC)branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    NWMN_0162(pflB)formate acetyltransferase  [1] (data from MRSA252)
    NWMN_0959(phdA)pyruvate dehydrogenase E1 component, alpha subunit  [1] (data from MRSA252)
    NWMN_0960(phdB)pyruvate dehydrogenase E1 component, beta subunit  [1] (data from MRSA252)
    NWMN_1592(pykA)pyruvate kinase  [1] (data from MRSA252)
    NWMN_2137(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    NWMN_0502(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    NWMN_1572(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    NWMN_1549(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    NWMN_2119(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    NWMN_1167(tsf)elongation factor Ts  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.146
    • Ymax_pos: 31
    • Cmax: 0.148
    • Cmax_pos: 31
    • Smax: 0.208
    • Smax_pos: 18
    • Smean: 0.132
    • D: 0.141
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKLEHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFTDYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPLAEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGLKTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICIFAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDKAQIGEIV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]