From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0458 [new locus tag: NWMN_RS02615 ]
  • pan locus tag?: SAUPAN002233000
  • symbol: ipk
  • pan gene symbol?: ipk
  • synonym:
  • product: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0458 [new locus tag: NWMN_RS02615 ]
  • symbol: ipk
  • product: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  • replicon: chromosome
  • strand: +
  • coordinates: 520719..521567
  • length: 849
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGATATATGAAACGGCACCAGCCAAAATTAATTTTACGCTCGATACACTTTTTAAAAGA
    AATGATGGCTATCATGAGATTGAAATGATAATGACAACAGTTGATTTAAATGATCGTTTA
    ACTTTTCATAAAAGAAAAGATCGAAAGATAGTTGTTGAGATTGAACATAATTATGTGCCT
    TCTAATCATAAAAATCTCGCATATCGTGCAGCGCAACTATTTATTGAGCAATATCAACTA
    AAGCAAGGTGTAACAATTTCTATCGATAAAGAAATACCTGTTTCTGCTGGCTTAGCTGGA
    GGTTCGGCTGATGCAGCAGCAACGTTAAGAGGATTGAATCGACTTTTTGATATAGGGGCG
    AGTTTGGAAGAATTGGCTCTACTAGGCAGTAAAATCGGGACAGATATTCCGTTTTGTATT
    TATAATAAAACTGCACTATGTACTGGAAGAGGAGAGAAAATCGAGTTTTTAAATAAACCA
    CCTTCAGCTTGGGTGATTCTTGCTAAACCAAACTTAGGCATATCATCACCAGATATATTT
    AAGTTGATTAATTTAGATAAGCGTTACGACGTACATACGAAAATGTGTTATGAGGCCTTA
    GAAAATCGAGATTATCAACAATTATGTCAAAGTTTGTCTAATCGATTAGAGCCAATTTCT
    GTTTCAAAACACCCACAAATCGATAAATTAAAAAATAATATGTTGAAAAGTGGTGCAGAT
    GGTGCGTTAATGAGTGGAAGCGGACCTACTGTGTATGGGCTAGCACGAAAAGAAAGCCAA
    GCAAAAAATATTTATAATGCAGTTAACGGTTGTTGTAATGAAGTGTACTTAGTTAGACTA
    TTAGGATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    849

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0458 [new locus tag: NWMN_RS02615 ]
  • symbol: Ipk
  • description: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  • length: 282
  • theoretical pI: 8.54156
  • theoretical MW: 31442
  • GRAVY: -0.251064

Function[edit source | edit]

  • reaction:
    EC 2.7.1.148?  ExPASy
    4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinaseATP + 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol = ADP + 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase (TIGR00154; EC 2.7.1.148; HMM-score: 297.4)
    MetabolismAmino acid biosynthesisAspartate familyhomoserine kinase (TIGR00191; EC 2.7.1.39; HMM-score: 52.3)
    MetabolismCentral intermediary metabolismOthermevalonate kinase (TIGR00549; EC 2.7.1.36; HMM-score: 39)
    MetabolismAmino acid biosynthesisAromatic amino acid familyshikimate kinase (TIGR01920; EC 2.7.1.71; HMM-score: 35.2)
    Unknown functionEnzymes of unknown specificitybeta-ribofuranosylaminobenzene 5'-phosphate synthase family (TIGR00144; HMM-score: 13.9)
    MetabolismCentral intermediary metabolismOtherdiphosphomevalonate decarboxylase (TIGR01240; EC 4.1.1.33; HMM-score: 12.3)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsIsoprenoidsIsoprenoid Biosynthesis 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148) 
  • PFAM:
    no clan definedGHMP_kinases_C; GHMP kinases C terminal (PF08544; HMM-score: 44.5)
    S5 (CL0329) GHMP_kinases_N; GHMP kinases N terminal domain (PF00288; HMM-score: 44.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.102
    • Ymax_pos: 52
    • Cmax: 0.111
    • Cmax_pos: 9
    • Smax: 0.123
    • Smax_pos: 44
    • Smean: 0.079
    • D: 0.093
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVPSNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGASLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIFKLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGADGALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]