From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002233000
  • symbol?: ipk
  • description?: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

      descriptions from strain specific annotations:

    • 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
    • 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • strand?: +
  • coordinates?: 2741457..2742305
  • synteny block?: BlockID0015320
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0538 (ipk)
    N315:
    SA0453 (ipk)
    NCTC8325:
    Newman:
    NWMN_0458 (ipk)
    USA300_FPR3757:
    04-02981:
    SA2981_0470
    08BA02176:
    C248_0550
    11819-97:
    MS7_0472 (ispE)
    71193:
    ST398NM01_0561
    ECT-R 2:
    ECTR2_435 (ispE)
    ED133:
    SAOV_0517 (ispE)
    ED98:
    SAAV_0442 (ipk)
    HO 5096 0412:
    SAEMRSA15_04210
    JH1:
    SaurJH1_0529 (ipk)
    JH9:
    SaurJH9_0516 (ipk)
    JKD6008:
    SAA6008_00499 (ispE)
    JKD6159:
    SAA6159_00446 (ispE)
    LGA251:
    SARLGA251_04290 (ispE)
    M013:
    M013TW_0466
    MRSA252:
    SAR0496 (ipk)
    MSHR1132:
    SAMSHR1132_04390
    MSSA476:
    SAS0452 (ipk)
    Mu3:
    SAHV_0492 (ipk)
    Mu50:
    SAV0495 (ipk)
    MW2:
    MW0450 (ipk)
    RF122:
    SAB0444 (ipk)
    ST398:
    SAPIG0561 (ispE)
    T0131:
    SAT0131_00540 (tal)
    TCH60:
    HMPREF0772_10025 (ispE)
    TW20:
    SATW20_05630 (ispE)
    USA300_TCH1516:
    VC40:
    SAVC_02060 (ipk)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
    N315            MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
    NCTC8325        MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
    Newman          MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
    USA300_FPR3757  MIYETAPAKINFTLDTLFKRNDGYHEIEMIMTTVDLNDRLTFHKRKDRKIVVEIEHNYVP
                    ************************************************************

    COL             SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
    N315            SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
    NCTC8325        SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
    Newman          SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
    USA300_FPR3757  SNHKNLAYRAAQLFIEQYQLKQGVTISIDKEIPVSAGLAGGSADAAATLRGLNRLFDIGA
                    ************************************************************

    COL             SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
    N315            SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
    NCTC8325        SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
    Newman          SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
    USA300_FPR3757  SLEELALLGSKIGTDIPFCIYNKTALCTGRGEKIEFLNKPPSAWVILAKPNLGISSPDIF
                    ************************************************************

    COL             KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
    N315            KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
    NCTC8325        KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
    Newman          KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
    USA300_FPR3757  KLINLDKRYDVHTKMCYEALENRDYQQLCQSLSNRLEPISVSKHPQIDKLKNNMLKSGAD
                    ************************************************************

    COL             GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
    N315            GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
    NCTC8325        GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
    Newman          GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
    USA300_FPR3757  GALMSGSGPTVYGLARKESQAKNIYNAVNGCCNEVYLVRLLG
                    ******************************************