From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0474 [new locus tag: NWMN_RS02710 ]
  • pan locus tag?: SAUPAN002254000
  • symbol: hslO
  • pan gene symbol?: hslO
  • synonym:
  • product: Hsp33-like chaperonin

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0474 [new locus tag: NWMN_RS02710 ]
  • symbol: hslO
  • product: Hsp33-like chaperonin
  • replicon: chromosome
  • strand: +
  • coordinates: 539659..540540
  • length: 882
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGACACACGATTATATTGTTAAAGCATTAGCATTTGATGGAGAGATTAGGGCTTATGCT
    GCTTTGACAACTGAAACTGTTCAAGAAGCACAAACGAGACATTATACATGGCCGACAGCA
    TCTGCTGCAATGGGAAGAACAATGACAGCAACAGCTATGATGGGCGCAATGTTGAAAGGT
    GATCAAAAATTAACTGTCACTGTAGATGGCCAAGGACCTATTGGACGAATTATTGCCGAT
    GCAAATGCTAAAGGCGAGGTGCGTGCTTATGTAGACCATCCACAAACTCATTTTCCATTA
    AATGAGCAAGGTAAACTTGATGTAAGACGAGCGGTAGGGACAAATGGATCTATTATGGTT
    GTTAAAGACGTTGGAATGAAAGACTATTTCTCTGGAGCAAGTCCAATTGTTTCAGGAGAA
    CTTGGTGAAGATTTTACTTATTATTATGCTACAAGTGAACAAACACCTTCATCGGTAGGT
    CTTGGTGTATTGGTAAATCCTGATAATACGATTAAAGCAGCAGGAGGATTTATCATTCAA
    GTTATGCCAGGTGCCAAAGATGAAACAATTTCAAAATTAGAAAAAGCAATTAGTGAAATG
    ACACCAGTTTCTAAATTAATTGAACAAGGATTAACGCCAGAAGGATTACTAAACGAAATC
    TTAGGTGAAGACCATGTGCAAATTTTAGAGAAAATGCCTGTTCAATTTGAATGTAATTGT
    AGTCATGAGAAATTTTTAAATGCTATTAAAGGATTGGGCGAGGCTGAGATTCAAAATATG
    ATTAAAGAAGATCATGGTGCTGAAGCAGTATGTCATTTCTGTGGAAATAAATATAAATAT
    ACTGAAGAAGAATTAAACGTGTTGCTAGAAAGTTTAGCGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    882

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0474 [new locus tag: NWMN_RS02710 ]
  • symbol: HslO
  • description: Hsp33-like chaperonin
  • length: 293
  • theoretical pI: 4.70599
  • theoretical MW: 31822
  • GRAVY: -0.196246

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Virulence, Disease and DefenseAdhesionStreptococcus pyogenes recombinatorial zone Chaperonin (heat shock protein 33) 
  • PFAM:
    no clan definedHSP33; Hsp33 protein (PF01430; HMM-score: 298.7)
    DUF2321; Uncharacterized protein conserved in bacteria (DUF2321) (PF10083; HMM-score: 12.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.167
    • Ymax_pos: 30
    • Cmax: 0.258
    • Cmax_pos: 43
    • Smax: 0.199
    • Smax_pos: 20
    • Smean: 0.101
    • D: 0.141
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKGDQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIMVVKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQVMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNCSHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]