From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002254000
  • symbol?: hslO
  • description?: heat shock protein 33

      descriptions from strain specific annotations:

    • heat shock protein 33
    • Hsp33-like chaperonin
    • Chaperonin (heat shock protein 33)
    • hsp33 family protein
    • 33 kDa chaperonin
    • putative chaperonin
    • redox regulated Hsp33-like chaperonin
    • chaperonin, 33 kDa
    • chaperonin HslO
  • strand?: +
  • coordinates?: 2762062..2762943
  • synteny block?: BlockID0015530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0556 (hslO)
    N315:
    SA0470 (hslO)
    NCTC8325:
    Newman:
    NWMN_0474 (hslO)
    USA300_FPR3757:
    04-02981:
    SA2981_0487
    08BA02176:
    C248_0568
    11819-97:
    MS7_0489 (hslO)
    71193:
    ST398NM01_0578
    ECT-R 2:
    ECTR2_452
    ED133:
    SAOV_0534
    ED98:
    SAAV_0459 (hslO)
    HO 5096 0412:
    SAEMRSA15_04380
    JH1:
    SaurJH1_0547 (hslO)
    JH9:
    SaurJH9_0534 (hslO)
    JKD6008:
    SAA6008_00517
    JKD6159:
    SAA6159_00463
    LGA251:
    SARLGA251_04460
    M013:
    M013TW_0484
    MRSA252:
    SAR0513 (hslO)
    MSHR1132:
    SAMSHR1132_04560
    MSSA476:
    SAS0469 (hslO)
    Mu3:
    SAHV_0509 (hslO)
    Mu50:
    SAV0512 (hslO)
    MW2:
    MW0467 (hslO)
    RF122:
    SAB0461 (hslO)
    ST398:
    SAPIG0578 (hslO)
    T0131:
    SAT0131_00559
    TCH60:
    HMPREF0772_10006 (hslO)
    TW20:
    SATW20_05800
    USA300_TCH1516:
    USA300HOU_0506 (hslO)
    VC40:
    SAVC_02145 (hslO)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKG
    N315            MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKG
    NCTC8325        MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKG
    Newman          MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKG
    USA300_FPR3757  MTHDYIVKALAFDGEIRAYAALTTETVQEAQTRHYTWPTASAAMGRTMTATAMMGAMLKG
                    ************************************************************

    COL             DQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIMV
    N315            DQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIIV
    NCTC8325        DQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIMV
    Newman          DQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIMV
    USA300_FPR3757  DQKLTVTVDGQGPIGRIIADANAKGEVRAYVDHPQTHFPLNEQGKLDVRRAVGTNGSIMV
                    **********************************************************:*

    COL             VKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQ
    N315            VKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQ
    NCTC8325        VKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQ
    Newman          VKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQ
    USA300_FPR3757  VKDVGMKDYFSGASPIVSGELGEDFTYYYATSEQTPSSVGLGVLVNPDNTIKAAGGFIIQ
                    ************************************************************

    COL             VMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNC
    N315            VMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNC
    NCTC8325        VMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNC
    Newman          VMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNC
    USA300_FPR3757  VMPGAKDETISKLEKAISEMTPVSKLIEQGLTPEGLLNEILGEDHVQILEKMPVQFECNC
                    ************************************************************

    COL             SHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA
    N315            SHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA
    NCTC8325        SHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA
    Newman          SHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA
    USA300_FPR3757  SHEKFLNAIKGLGEAEIQNMIKEDHGAEAVCHFCGNKYKYTEEELNVLLESLA
                    *****************************************************