From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0494 [new locus tag: NWMN_RS02885 ]
  • pan locus tag?: SAUPAN002300000
  • symbol: NWMN_0494
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0494 [new locus tag: NWMN_RS02885 ]
  • symbol: NWMN_0494
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 569416..570162
  • length: 747
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    GTGGAAGATACGGTTATTGTTGGTAGGCATGCTGTTAGAGAAGCGATTATTACTGGGCAT
    CCGATAAATAAGATATTGATTCAAGAAGGTATTAAAAAGCAACAAATTAATGAAATTTTA
    AAAAATGCAAAAGATCAAAAAATCATTGTTCAAACTGTACCAAAATCTAAATTAGATTTT
    TTAGCAAATGCACCACATCAGGGTGTTGCAGCGCTTATTGCACCATATGAATATGCTGAC
    TTCGATCAATTTTTAAAACAGCAAAAAGAAAAAGAAGGTTTATTGACAGTACTTATATTA
    GACGGCTTAGAAGACCCACATAACTTGGGATCAATTTTAAGAACAGCCGATGCAACGGGA
    GTTGATGGTGTTATTATTCCTAAACGTCGTTCAGTTACACTAACGCAAACAGTTGCAAAA
    GCCTCAACAGGTGCAATTGAACATGTACCAGTTATTCGAGTGACAAATTTAGCTAAAACT
    ATCGATGAACTAAAAGATAATGGCTTTTGGGTAGCTGGCACTGAAGCTAATAATGCAACA
    GATTATAGAAATCTAGAAGCGGACATGTCATTGGCTATTGTAATTGGTAGCGAAGGACAG
    GGTATGAGTCGCCTAGTAAGTGATAAATGCGATTTTTATATTAAGATTCCAATGGTTGGA
    CATGTAAACAGTTTGAATGCTTCGGTTGCAGCAAGTTTAATGATGTACGAAGTATTTCGA
    AAAAGACATGATGTTGGAGAAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    747

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0494 [new locus tag: NWMN_RS02885 ]
  • symbol: NWMN_0494
  • description: hypothetical protein
  • length: 248
  • theoretical pI: 6.63672
  • theoretical MW: 27207.2
  • GRAVY: -0.0802419

Function[edit source | edit]

  • reaction:
    EC 2.1.1.-?  ExPASy
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationRNA methyltransferase, TrmH family, group 3 (TIGR00186; HMM-score: 257.6)
    Genetic information processingProtein synthesistRNA and rRNA base modificationtRNA (cytidine(34)-2'-O)-methyltransferase (TIGR00185; EC 2.1.1.207; HMM-score: 46.8)
    Genetic information processingProtein synthesistRNA and rRNA base modificationRNA methyltransferase, TrmH family, group 1 (TIGR00050; EC 2.1.1.-; HMM-score: 39.7)
  • TheSEED:  
    Conserved gene cluster possibly involved in RNA metabolism 23S rRNA (guanosine-2'-O-) -methyltransferase rlmB (EC 2.1.1.-) 
  • PFAM:
    SPOUT (CL0098) SpoU_methylase; SpoU rRNA Methylase family (PF00588; HMM-score: 140)
    PELOTA (CL0101) SpoU_sub_bind; RNA 2'-O ribose methyltransferase substrate binding (PF08032; HMM-score: 76.5)
    no clan definedDUF3368; Domain of unknown function (DUF3368) (PF11848; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 35
    • Cmax: 0.112
    • Cmax_pos: 28
    • Smax: 0.131
    • Smax_pos: 24
    • Smean: 0.088
    • D: 0.103
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDFLANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATGVDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNATDYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEVFRKRHDVGEI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]