From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002300000
  • symbol?:
  • description?: 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB

      descriptions from strain specific annotations:

    • 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB
    • RNA methyltransferase
    • 23S rRNA Gm2251-methyltransferase
    • Putative trmH family tRNA/rRNA methyltransferase
    • RNA 2'-O ribose methyltransferase substrate binding family protein
    • RNA methyltransferase, TrmH family
    • RNA methyltransferase, TrmH family, group 3
    • SpoU rRNA methylase family protein
    • TrmH family RNA methyltransferase
    • TrmH family tRNA/rRNA methyltransferase YacO
    • tRNA/rRNA methyltransferase
  • strand?: +
  • coordinates?: 2821022..2821768
  • synteny block?: BlockID0015990
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0507
    08BA02176:
    C248_0605 (yacO)
    11819-97:
    MS7_0521
    71193:
    ST398NM01_0607
    ECT-R 2:
    ECTR2_485
    ED133:
    SAOV_0567
    ED98:
    SAAV_0493
    HO 5096 0412:
    SAEMRSA15_04580 (yacO)
    JH1:
    SaurJH1_0568
    JH9:
    SaurJH9_0554
    JKD6008:
    SAA6008_00538 (yacO)
    JKD6159:
    SAA6159_00485 (yacO)
    LGA251:
    SARLGA251_04670 (yacO)
    M013:
    M013TW_0516
    MRSA252:
    SAR0535 (yacO)
    MSHR1132:
    SAMSHR1132_04760
    MSSA476:
    SAS0489
    Mu3:
    SAHV_0529
    Mu50:
    SAV0531
    MW2:
    MW0487
    RF122:
    SAB0482
    ST398:
    SAPIG0607
    T0131:
    SAT0131_00584 (bsaE)
    TCH60:
    HMPREF0772_12658 (rlmB)
    TW20:
    SATW20_06010 (yacO)
    USA300_TCH1516:
    USA300HOU_0525
    VC40:
    SAVC_02245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDF
    N315            MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDF
    NCTC8325        MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDF
    Newman          MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDF
    USA300_FPR3757  MEDTVIVGRHAVREAIITGHPINKILIQEGIKKQQINEILKNAKDQKIIVQTVPKSKLDF
                    ************************************************************

    COL             LANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATG
    N315            LANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLSTVLILDGLEDPHNLGSILRTADATG
    NCTC8325        LANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATG
    Newman          LANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATG
    USA300_FPR3757  LANAPHQGVAALIAPYEYADFDQFLKQQKEKEGLLTVLILDGLEDPHNLGSILRTADATG
                    ********************************** *************************

    COL             VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT
    N315            VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT
    NCTC8325        VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT
    Newman          VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT
    USA300_FPR3757  VDGVIIPKRRSVTLTQTVAKASTGAIEHVPVIRVTNLAKTIDELKDNGFWVAGTEANNAT
                    ************************************************************

    COL             DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEVFR
    N315            DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEVFR
    NCTC8325        DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEVFR
    Newman          DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEVFR
    USA300_FPR3757  DYRNLEADMSLAIVIGSEGQGMSRLVSDKCDFYIKIPMVGHVNSLNASVAASLMMYEVFR
                    ************************************************************

    COL             KRHDVGEI
    N315            KRHDVGEI
    NCTC8325        KRHDVGEI
    Newman          KRHDVGEI
    USA300_FPR3757  KRHDVGEI
                    ********