From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0512 [new locus tag: NWMN_RS02975 ]
  • pan locus tag?: SAUPAN002322000
  • symbol: NWMN_0512
  • pan gene symbol?: kbl
  • synonym:
  • product: 2-amino-3-ketobutyrate coenzyme A ligase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0512 [new locus tag: NWMN_RS02975 ]
  • symbol: NWMN_0512
  • product: 2-amino-3-ketobutyrate coenzyme A ligase
  • replicon: chromosome
  • strand: +
  • coordinates: 590059..591246
  • length: 1188
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    GTGGTTCAATCATTACATGAGTTTTTAGAGGAAAATATAAATTATCTAAAAGAAAATGGT
    TTGTATAATGAAATAGATACAATTGAAGGTGCAAACGGACCAGAAATCAAAATCAATGGG
    AAATCATACATTAACTTATCTTCAAATAATTATTTAGGACTAGCAACAAATGAAGATTTG
    AAATCAGCTGCAAAAGCAGCTATTGATACACATGGTGTAGGTGCAGGCGCTGTTCGTACA
    ATCAATGGTACATTAGATTTACACGACGAATTAGAAGAAACACTAGCAAAATTTAAAGGA
    ACAGAAGCTGCAATAGCTTATCAATCAGGATTTAATTGTAATATGGCTGCTATTTCAGCT
    GTCATGAATAAAAATGATGCTATTTTATCAGATGAGCTTAATCATGCATCAATTATTGAT
    GGATGTCGCTTATCTAAAGCTAAAATTATTCGAGTTAACCATTCAGACATGGATGATTTA
    CGTGCGAAAGCAAAAGAAGCAGTTGAATCAGGTCAATACAATAAAGTGATGTATATCACT
    GATGGCGTTTTTAGTATGGATGGTGATGTGGCTAAATTACCTGAAATTGTAGAAATTGCA
    GAAGAATTTGGTTTATTAACTTATGTTGACGACGCTCATGGTTCAGGTGTTATGGGTAAA
    GGCGCTGGTACGGTTAAACATTTTGGTTTACAAGATAAAATCGATTTCCAAATAGGTACG
    CTTTCTAAAGCAATTGGTGTCGTTGGCGGTTATGTAGCAGGTACAAAAGAGTTAATAGAT
    TGGTTAAAAGCACAATCACGACCATTCTTATTCTCTACATCATTAGCACCTGGGGATACC
    AAAGCAATAACTGAAGCAGTTAAAAAGTTAATGGATTCAACTGAATTACATGATAAATTA
    TGGAACAATGCACAATATTTAAAAAATGGATTGTCAAAATTAGGATATGATACAGGTGAG
    TCAGAAACTCCAATTACACCAGTAATTATTGGTGATGAAAAAACAACTCAAGAATTTAGT
    AAGCGTTTAAAAGACGAAGGTGTCTATGTGAAATCTATCGTTTTCCCAACAGTACCAAGA
    GGTACAGGACGTGTAAGAAATATGCCTACAGCTGCACATACAAAAGACATGTTAGATGAA
    GCAATTGCGGCTTATGAAAAAGTAGGAAAAGAAATGAAGTTGATTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1188

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0512 [new locus tag: NWMN_RS02975 ]
  • symbol: NWMN_0512
  • description: 2-amino-3-ketobutyrate coenzyme A ligase
  • length: 395
  • theoretical pI: 5.00874
  • theoretical MW: 42890.3
  • GRAVY: -0.268354

Function[edit source | edit]

  • reaction:
    EC 2.3.1.29?  ExPASy
    Glycine C-acetyltransferaseAcetyl-CoA + glycine = CoA + 2-amino-3-oxobutanoate
  • TIGRFAM:
    putative pyridoxal phosphate-dependent acyltransferase (TIGR01825; EC 2.3.1.-; HMM-score: 692.5)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotin8-amino-7-oxononanoate synthase (TIGR00858; EC 2.3.1.47; HMM-score: 403.6)
    MetabolismEnergy metabolismAmino acids and aminesglycine C-acetyltransferase (TIGR01822; EC 2.3.1.29; HMM-score: 386.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamin5-aminolevulinic acid synthase (TIGR01821; EC 2.3.1.37; HMM-score: 285.7)
    MetabolismEnergy metabolismAmino acids and aminesmethionine gamma-lyase (TIGR01328; EC 4.4.1.11; HMM-score: 27.2)
    MetabolismAmino acid biosynthesisHistidine familyhistidinol-phosphate transaminase (TIGR01141; EC 2.6.1.9; HMM-score: 22.9)
    MetabolismAmino acid biosynthesisAspartate familyO-succinylhomoserine sulfhydrylase (TIGR01325; EC 4.2.99.-; HMM-score: 19.8)
    Unknown functionEnzymes of unknown specificitypyridoxal phosphate enzyme, MJ0158 family (TIGR03576; HMM-score: 19.8)
    MetabolismAmino acid biosynthesisAspartate familyO-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 16.4)
    MetabolismAmino acid biosynthesisSerine familyO-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 16.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthertyrosine decarboxylase MnfA (TIGR03812; EC 4.1.1.25; HMM-score: 15.3)
    MetabolismAmino acid biosynthesisAspartate familycystathionine beta-lyase (TIGR01324; EC 4.4.1.8; HMM-score: 13.7)
    O-phospho-L-seryl-tRNA:Cys-tRNA synthase (TIGR02539; EC 2.5.1.73; HMM-score: 12.2)
    cystathionine beta-lyase (TIGR01329; EC 4.4.1.8; HMM-score: 11.4)
  • TheSEED:  
    Amino Acids and DerivativesAlanine, serine, and glycineGlycine and Serine Utilization 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) 
    Alanine, serine, and glycineGlycine Biosynthesis 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) 
    Lysine, threonine, methionine, and cysteineThreonine degradation 2-amino-3-ketobutyrate coenzyme A ligase (EC 2.3.1.29) 
  • PFAM:
    PLP_aminotran (CL0061) Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 233.6)
    Cys_Met_Meta_PP; Cys/Met metabolism PLP-dependent enzyme (PF01053; HMM-score: 27.7)
    DegT_DnrJ_EryC1; DegT/DnrJ/EryC1/StrS aminotransferase family (PF01041; HMM-score: 18.5)
    Beta_elim_lyase; Beta-eliminating lyase (PF01212; HMM-score: 18.4)
    no clan definedMMR_HSR1_Xtn; C-terminal region of MMR_HSR1 domain (PF16897; HMM-score: 13.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 31
    • Cmax: 0.12
    • Cmax_pos: 67
    • Smax: 0.182
    • Smax_pos: 29
    • Smean: 0.131
    • D: 0.124
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDLKSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAAIAYQSGFNCNMAAISAVMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKEAVESGQYNKVMYITDGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGAGTVKHFGLQDKIDFQIGTLSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKLWNNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFSKRLKDEGVYVKSIVFPTVPRGTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolismRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]