Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002322000
  • symbol?: kbl
  • description?: 2-amino-3-ketobutyrate CoA ligase

      descriptions from strain specific annotations:

    • 2-amino-3-ketobutyrate CoA ligase
    • 2-amino-3-ketobutyrate coenzyme A ligase
    • 8-amino-7-oxononanoate synthase
    • pyridoxal phosphate-dependent acyltransferase family protein
    • putative 2-amino-3-ketobutyrate coenzyme Aligase
    • putative pyridoxal phosphate-dependent acyltransferase
    • Putative 8-amino-7-oxononanoate synthase/2-amino-3-ketobutyrate coenzyme A ligase
    • glycine C-acetyltransferase
    • 8-amino-7-oxononanoate synthase (aons) (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase)(7-kap synthetase) (l-alanine--pimelyl coa ligase)
  • strand?: +
  • coordinates?: 2841773..2842960
  • synteny block?: BlockID0016210
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0527
    08BA02176:
    C248_0625 (kbl)
    11819-97:
    MS7_0540
    71193:
    ST398NM01_0625
    ECT-R 2:
    ECTR2_504
    ED133:
    SAOV_0585
    ED98:
    SAAV_0513
    HO 5096 0412:
    SAEMRSA15_04770 (kbl)
    JH1:
    SaurJH1_0587
    JH9:
    SaurJH9_0573
    JKD6008:
    SAA6008_00556 (kbl)
    JKD6159:
    SAA6159_00504 (kbl)
    LGA251:
    SARLGA251_04860 (kbl)
    M013:
    M013TW_0537
    MRSA252:
    SAR0555 (kbl)
    MSHR1132:
    SAMSHR1132_04940
    MSSA476:
    SAS0508
    Mu3:
    SAHV_0548
    Mu50:
    SAV0550
    MW2:
    MW0505
    RF122:
    SAB0501 (kbl)
    ST398:
    SAPIG0625
    T0131:
    SAT0131_00603
    TCH60:
    HMPREF0772_12639 (kbl)
    TW20:
    SATW20_06200 (kbl)
    USA300_TCH1516:
    USA300HOU_0543 (kbl)
    VC40:
    SAVC_02340

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDL
    N315            MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDL
    NCTC8325        MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDL
    Newman          MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDL
    USA300_FPR3757  MVQSLHEFLEENINYLKENGLYNEIDTIEGANGPEIKINGKSYINLSSNNYLGLATNEDL
                    ************************************************************

    COL             KSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAAIAYQSGFNCNMAAISA
    N315            KSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAAIAYQSGFNCNMAAISA
    NCTC8325        KSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAAIAYQSGFNCNMAAISA
    Newman          KSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAAIAYQSGFNCNMAAISA
    USA300_FPR3757  KSAAKAAIDTHGVGAGAVRTINGTLDLHDELEETLAKFKGTEAAIAYQSGFNCNMAAISA
                    ************************************************************

    COL             VMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKEAVESGQYNKVMYIT
    N315            VMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKEAVESGQYNKVMYIT
    NCTC8325        VMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKEAVESGQYNKVMYIT
    Newman          VMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKEAVESGQYNKVMYIT
    USA300_FPR3757  VMNKNDAILSDELNHASIIDGCRLSKAKIIRVNHSDMDDLRAKAKEAVESGQYNKVMYIT
                    ************************************************************

    COL             DGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGAGTVKHFGLQDKIDFQIGT
    N315            DGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGAGTVKHFGLQDKIDFQIGT
    NCTC8325        DGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGAGTVKHFGLQDKIDFQIGT
    Newman          DGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGAGTVKHFGLQDKIDFQIGT
    USA300_FPR3757  DGVFSMDGDVAKLPEIVEIAEEFGLLTYVDDAHGSGVMGKGAGTVKHFGLQDKIDFQIGT
                    ************************************************************

    COL             LSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKL
    N315            LSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKL
    NCTC8325        LSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKL
    Newman          LSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKL
    USA300_FPR3757  LSKAIGVVGGYVAGTKELIDWLKAQSRPFLFSTSLAPGDTKAITEAVKKLMDSTELHDKL
                    ************************************************************

    COL             WNNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFSKRLKDEGVYVKSIVFPTVPR
    N315            WDNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFSKRLKDEGVYVKSIVFPTVPR
    NCTC8325        WNNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFSKRLKDEGVYVKSIVFPTVPR
    Newman          WNNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFSKRLKDEGVYVKSIVFPTVPR
    USA300_FPR3757  WNNAQYLKNGLSKLGYDTGESETPITPVIIGDEKTTQEFSKRLKDEGVYVKSIVFPTVPR
                    *:**********************************************************

    COL             GTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI
    N315            GTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI
    NCTC8325        GTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI
    Newman          GTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI
    USA300_FPR3757  GTGRVRNMPTAAHTKDMLDEAIAAYEKVGKEMKLI
                    ***********************************