From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0520 [new locus tag: NWMN_RS03015 ]
  • pan locus tag?: SAUPAN002331000
  • symbol: NWMN_0520
  • pan gene symbol?: tadA
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0520 [new locus tag: NWMN_RS03015 ]
  • symbol: NWMN_0520
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 599165..599635
  • length: 471
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGACAAATGATATATATTTTATGACATTAGCGATTGAAGAAGCTAAAAAAGCAGCTCAA
    CTAGGCGAAGTACCTATAGGTGCTATCATCACTAAAGATGATGAAGTTATCGCTAGAGCA
    CATAATTTAAGAGAAACACTACAACAACCAACGGCGCATGCTGAACATATTGCAATTGAA
    CGTGCAGCCAAAGTGTTAGGTAGTTGGCGTTTAGAAGGTTGCACATTATATGTAACCTTA
    GAACCATGTGTCATGTGCGCAGGAACAATTGTAATGAGTCGCATTCCAAGAGTCGTCTAT
    GGCGCAGATGATCCTAAAGGTGGTTGTAGTGGCAGTTTAATGAATTTATTGCAACAATCT
    AATTTTAATCATCGTGCAATTGTTGATAAAGGTGTACTTAAAGAAGCATGTAGCACATTA
    TTAACAACATTTTTTAAAAACTTAAGAGCCAATAAGAAATCCACCAATTAG
    60
    120
    180
    240
    300
    360
    420
    471

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0520 [new locus tag: NWMN_RS03015 ]
  • symbol: NWMN_0520
  • description: hypothetical protein
  • length: 156
  • theoretical pI: 8.21852
  • theoretical MW: 17089.7
  • GRAVY: -0.05

Function[edit source | edit]

  • reaction:
    EC 3.5.4.33?  ExPASy
    tRNA(adenine34) deaminaseAdenine34 in tRNA + H2O = hypoxanthine34 in tRNA + NH3
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersRiboflavin, FMN, and FADriboflavin biosynthesis protein RibD (TIGR00326; EC 1.1.1.193,3.5.4.26; HMM-score: 53.9)
    ComE operon protein 2 (TIGR02571; HMM-score: 29.3)
  • TheSEED:  
    tRNA processing tRNA-specific adenosine-34 deaminase (EC 3.5.4.33) 
  • PFAM:
    CDA (CL0109) MafB19-deam; MafB19-like deaminase (PF14437; HMM-score: 142.3)
    dCMP_cyt_deam_1; Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383; HMM-score: 100)
    Bd3614-deam; Bd3614-like deaminase (PF14439; HMM-score: 22.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.157
    • Ymax_pos: 55
    • Cmax: 0.308
    • Cmax_pos: 55
    • Smax: 0.191
    • Smax_pos: 17
    • Smean: 0.094
    • D: 0.133
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRANKKSTN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]