From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0543 [new locus tag: NWMN_RS03120 ]
  • pan locus tag?: SAUPAN002357000
  • symbol: thiD
  • pan gene symbol?: pdxK
  • synonym:
  • product: phosphomethylpyrimidine kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0543 [new locus tag: NWMN_RS03120 ]
  • symbol: thiD
  • product: phosphomethylpyrimidine kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 627641..628471
  • length: 831
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGCTTTAAAGAAAGTTTTAACAATTGCCGGTTCTGACACAAGTGCTGGCGCAGGTATG
    CAAGCAGATTTGAAAACGTTCCAAGAATTAGATACGTATGGCATGGTCGCTTTAACTGCC
    ATCGTTACTATGGATAAAGATACATGGTCACACGATGTTACACCATTACCAATGGATGTA
    TTTGAAAAACAACTTGAAACGGCTTTATCAATCGGACCTGATGCTATTAAAACAGGTATG
    TTAGGTACTGAGGAGATAATCAAACGTGCTGGAGAAGTATATGAGGCATCTAATGCACAA
    TATTTTGTAGTAGATCCTGTCATGGTTTGTAAAGGCGAAGATGAAGTGCTTAATCCTGGA
    AATACTGAGGCGATGATTAAATATTTACTACCTAAAGCAACGGTAGTGGCACCAAACTTA
    TTTGAAGCGGGTCAATTATCAGGATTAGGTAAATTAAATTCAATTGAAGATATGAAAAAG
    GCTGCAACAATTATCTTTGATAAAGGCGCACAGCATGTCATCATTAAAGGTGGCAAAGCT
    TTAGATCAAGATAAATCGTATGACTTATACTATGATGGTCAAACATTTTATCAACTAACA
    ACAGACATGTTCCAACAAAGTTATAACCATGGTGCTGGTTGTACATTTGCTGCGGCAACA
    ACTGCATATTTAGCTAACGGTAAGTCACCGAAAGAAGCTGTGATTAGCGCGAAAGCTTTC
    GTCGCTTCTGCTATTAAAAACGGTTGGAAAATGAATGATTTTGTTGGTCCTGTGGATCAC
    GGTGCATACAACCGTATTGAACATATCGATGTTGAAGTAACAGAGGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0543 [new locus tag: NWMN_RS03120 ]
  • symbol: ThiD
  • description: phosphomethylpyrimidine kinase
  • length: 276
  • theoretical pI: 4.61494
  • theoretical MW: 29826.8
  • GRAVY: -0.0963768

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersThiaminehydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 232.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal kinase (TIGR00687; EC 2.7.1.35; HMM-score: 53.6)
    MetabolismEnergy metabolismSugarsribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 36.8)
    hexose kinase, 1-phosphofructokinase family (TIGR03168; EC 2.7.1.-; HMM-score: 26.9)
    1-phosphofructokinase (TIGR03828; EC 2.7.1.56; HMM-score: 23.9)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesbifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 17.7)
    MetabolismEnergy metabolismSugars5-dehydro-2-deoxygluconokinase (TIGR04382; EC 2.7.1.92; HMM-score: 17.4)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidestagatose-6-phosphate kinase (TIGR01231; EC 2.7.1.144; HMM-score: 13.2)
  • TheSEED:  
    Novel pyridoxal kinase, thiD family (EC 2.7.1.35) 
  • PFAM:
    Ribokinase (CL0118) Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 256.6)
    PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 37.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.21
    • Ymax_pos: 23
    • Cmax: 0.152
    • Cmax_pos: 23
    • Smax: 0.525
    • Smax_pos: 16
    • Smean: 0.321
    • D: 0.253
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MALKKVLTIAGSDTSAGAGMQADLKTFQELDTYGMVALTAIVTMDKDTWSHDVTPLPMDVFEKQLETALSIGPDAIKTGMLGTEEIIKRAGEVYEASNAQYFVVDPVMVCKGEDEVLNPGNTEAMIKYLLPKATVVAPNLFEAGQLSGLGKLNSIEDMKKAATIIFDKGAQHVIIKGGKALDQDKSYDLYYDGQTFYQLTTDMFQQSYNHGAGCTFAAATTAYLANGKSPKEAVISAKAFVASAIKNGWKMNDFVGPVDHGAYNRIEHIDVEVTEV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]