From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0621 [new locus tag: NWMN_RS03530 ]
  • pan locus tag?: SAUPAN002530000
  • symbol: NWMN_0621
  • pan gene symbol?: dhaM
  • synonym:
  • product: phosphotransferase mannnose-specific family component IIA

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0621 [new locus tag: NWMN_RS03530 ]
  • symbol: NWMN_0621
  • product: phosphotransferase mannnose-specific family component IIA
  • replicon: chromosome
  • strand: +
  • coordinates: 703145..703522
  • length: 378
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    TTGGAGATGAAGATAATGCCTAAAATTATACTTGTTAGCCACAGTAAAGAAATTGCAAGT
    GGTACAAAATCTTTGTTAAAGCAAATGGCAGGTGACGTTGATATTATACCAATCGGGGGA
    TTACCAGATGGTTCAATTGGAACTTCATTTGATATCATCCAAGAAGTTTTGACTAAATTA
    GAGGATGATGCATTGTGTTTTTACGATATTGGATCTTCAGAAATGAATGTAGATATGGCA
    ATTGAAATGTATGATGGTAATCATCGTGTGTTAAAAGTTGATGCACCAATTGTTGAAGGC
    AGTTTTATCGCAGCAGTAAAGCTATCAATCGGCGGTTCAATTGATGATGCATTAGCAGAA
    ATCAAACAATCATTTTAG
    60
    120
    180
    240
    300
    360
    378

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0621 [new locus tag: NWMN_RS03530 ]
  • symbol: NWMN_0621
  • description: phosphotransferase mannnose-specific family component IIA
  • length: 125
  • theoretical pI: 4.17656
  • theoretical MW: 13417.5
  • GRAVY: 0.2616

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    dihydroxyacetone kinase, phosphotransfer subunit (TIGR02364; HMM-score: 144.6)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismDihydroxyacetone kinases DHA-specific IIA component 
    Central carbohydrate metabolismDihydroxyacetone kinases Phosphoenolpyruvate-dihydroxyacetone phosphotransferase (EC 2.7.1.121), subunit DhaM 
  • PFAM:
    EDD (CL0245) EIIA-man; PTS system fructose IIA component (PF03610; HMM-score: 96.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.19
    • Ymax_pos: 20
    • Cmax: 0.128
    • Cmax_pos: 20
    • Smax: 0.336
    • Smax_pos: 10
    • Smean: 0.274
    • D: 0.223
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEMKIMPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSFDIIQEVLTKLEDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLSIGGSIDDALAEIKQSF

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: CcpA
    CcpA (TF) important in Carbon catabolismRegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]