From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002530000
  • symbol?: dhaM
  • description?: PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM

      descriptions from strain specific annotations:

    • PTS-dependent dihydroxyacetone kinase phosphotransferase subunit DhaM
    • phosphotransferase mannnose-specific family component IIA
    • PTS system mannnose-specific transporter subunit IIA
    • PTS system mannnose-specific family transporter subunit IIA
    • Phosphoenolpyruvate-dihydroxyacetone phosphotransferase, subunit DhaM
    • DHA-specific IIA component
    • dihydroxyacetone kinase, phosphotransfer subunit
    • PTS-dependent dihydroxyacetone kinase, phosphotransferase subunit dhaM
    • PTS-dependent dihydroxyacetone kinase phosphotransfer protein
    • putative PTS transport system, IIA component
  • strand?: +
  • coordinates?: 3042599..3042977
  • synteny block?: BlockID0017660
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0628 (dhaM)
    08BA02176:
    C248_0735
    11819-97:
    MS7_0702 (dhaM)
    71193:
    ST398NM01_0730
    ECT-R 2:
    ECTR2_603
    ED133:
    SAOV_0686
    ED98:
    SAAV_0614
    HO 5096 0412:
    SAEMRSA15_05780
    JH1:
    SaurJH1_0690
    JH9:
    SaurJH9_0675
    JKD6008:
    SAA6008_00668 (dhaM)
    JKD6159:
    SAA6159_00606 (dhaM)
    LGA251:
    SARLGA251_05850
    M013:
    M013TW_0639
    MRSA252:
    SAR0662
    MSHR1132:
    SAMSHR1132_05980
    MSSA476:
    SAS0617
    Mu3:
    SAHV_0649
    Mu50:
    SAV0652
    MW2:
    MW0614
    RF122:
    SAB0601
    ST398:
    SAPIG0730
    T0131:
    SAT0131_00722 (nadC)
    TCH60:
    HMPREF0772_12536
    TW20:
    SATW20_07270
    USA300_TCH1516:
    USA300HOU_0673
    VC40:
    SAVC_02890

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             -----MPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSFDIIQEVLTKL
    N315            -----MPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSFDIIQEVLTKL
    NCTC8325        -----MPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSFDIIQEVLTKL
    Newman          MEMKIMPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSFDIIQEVLTKL
    USA300_FPR3757  -----MPKIILVSHSKEIASGTKSLLKQMAGDVDIIPIGGLPDGSIGTSFDIIQEVLTKL
                         *******************************************************

    COL             EDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLSIGGSIDDALAE
    N315            EDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLSIGGSIDDALAE
    NCTC8325        EDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLSIGGSIDDALAE
    Newman          EDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLSIGGSIDDALAE
    USA300_FPR3757  EDDALCFYDIGSSEMNVDMAIEMYDGNHRVLKVDAPIVEGSFIAAVKLSIGGSIDDALAE
                    ************************************************************

    COL             IKQSF
    N315            IKQSF
    NCTC8325        IKQSF
    Newman          IKQSF
    USA300_FPR3757  IKQSF
                    *****