From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0664 [new locus tag: NWMN_RS03760 ]
  • pan locus tag?: SAUPAN002579000
  • symbol: norA
  • pan gene symbol?: norA
  • synonym:
  • product: quinolone resistance norA protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0664 [new locus tag: NWMN_RS03760 ]
  • symbol: norA
  • product: quinolone resistance norA protein
  • replicon: chromosome
  • strand: +
  • coordinates: 744851..746017
  • length: 1167
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    ATGAATAAACAGATTTTTGTCTTATATTTTAATATTTTCTTGATTTTTTTAGGTATCGGT
    TTAGTAATACCAGTCTTGCCTGTTTATTTAAAAGATTTGGGATTAACTGGTAGTGATTTA
    GGATTACTAGTTGCTGCTTTTGCGTTATCTCAAATGATTATATCGCCGTTTGGTGGTACG
    CTAGCTGACAAATTAGGGAAGAAATTAATTATATGTATAGGATTAATTTTGTTTTCAGTG
    TCAGAATTTATGTTTGCAGTTGGCCACAATTTTTCGGTATTGATGTTATCGAGAGTGATT
    GGTGGTATGAGTGCTGGTATGGTAATGCCTGGTGTGACAGGTTTAATAGCTGACATTTCA
    CCAAGCCATCAAAAAGCAAAAAACTTTGGCTACATGTCAGCGATTATCAATTCTGGATTC
    ATTTTAGGACCAGGGATTGGTGGATTTATGGCAGAAGTTTCACATCGTATGCCATTTTAC
    TTTGCAGGAGCATTAGGTATTCTAGCATTTATAATGTCAATTGTATTGATTCACGATCCG
    AAAAAGTCTACGACAAGTGGTTTCCAAAAGTTAGAGCCACAATTGCTAACGAAAATTAAC
    TGGAAAGTGTTTATTACACCAGTTATTTTAACACTTGTATTATCGTTTGGTTTATCTGCA
    TTTGAAACATTGTATTCACTATACACAGCTGACAAGGTAAATTATTCACCTAAAGATATT
    TCGATTGCTATTACGGGTGGCGGTATATTTGGGGCACTTTTCCAAATCTATTTCTTCGAT
    AAATTTATGAAGTATTTCTCAGAGTTAACATTTATAGCTTGGTCATTATTATATTCAGTT
    GTTGTCTTAATATTATTAGTTTTTGCTAATGACTATTGGTCAATAATGTTAATCAGTTTT
    GTTGTCTTCATAGGTTTTGATATGATACGACCAGCCATTACAAATTATTTTTCTAATATT
    GCTGGAGAAAGGCAAGGCTTTGCAGGCGGATTGAACTCGACATTCACTAGTATGGGTAAT
    TTCATAGGTCCTTTAATCGCAGGTGCGTTATTTGATGTACACATTGAAGCACCAATTTAT
    ATGGCTATAGGTGTTTCATTAGCAGGTGTTGTTATTGTTTTAATTGAAAAGCAACATAGA
    GCAAAATTGAAAGAACAAAATATGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1167

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0664 [new locus tag: NWMN_RS03760 ]
  • symbol: NorA
  • description: quinolone resistance norA protein
  • length: 388
  • theoretical pI: 9.29049
  • theoretical MW: 42323.2
  • GRAVY: 0.85

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    multidrug resistance protein (TIGR00880; HMM-score: 142.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsD-galactonate transporter (TIGR00893; HMM-score: 71.4)
    Cellular processesCellular processesToxin production and resistancedrug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family (TIGR00711; HMM-score: 64.3)
    MetabolismTransport and binding proteinsOtherdrug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family (TIGR00711; HMM-score: 64.3)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsH+ Antiporter protein (TIGR00900; HMM-score: 57.7)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, aromatic acid:H+ symporter (AAHS) family (TIGR00895; HMM-score: 55.1)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsphosphoglycerate transporter family protein (TIGR00881; HMM-score: 54.6)
    drug resistance transporter, Bcr/CflA subfamily (TIGR00710; HMM-score: 52.6)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidssugar efflux transporter (TIGR00899; HMM-score: 50)
    MetabolismTransport and binding proteinsAnionsNa(+)-dependent inorganic phosphate cotransporter (TIGR00894; HMM-score: 42.5)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, sugar porter (SP) family (TIGR00879; HMM-score: 29)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsMFS transporter, sialate:H+ symporter (SHS) family (TIGR00891; HMM-score: 25.5)
    MetabolismTransport and binding proteinsCations and iron carrying compoundscation transport protein (TIGR00898; HMM-score: 23.7)
    synaptic vesicle protein SV2 (TIGR01299; HMM-score: 23.5)
    MetabolismTransport and binding proteinsOthercyanate transporter (TIGR00896; HMM-score: 21.5)
    oxalate/formate antiporter (TIGR04259; HMM-score: 20.1)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidspolyol permease (TIGR00897; HMM-score: 9.8)
    MetabolismTransport and binding proteinsCarbohydrates, organic alcohols, and acidsoxalate/formate antiporter family transporter (TIGR00890; HMM-score: 4.8)
  • TheSEED:  
    Quinolone resistance protein norA 
  • PFAM:
    MFS (CL0015) MFS_1; Major Facilitator Superfamily (PF07690; HMM-score: 202.3)
    MFS_1_like; MFS_1 like family (PF12832; HMM-score: 56.4)
    Sugar_tr; Sugar (and other) transporter (PF00083; HMM-score: 44.6)
    MFS_3; Transmembrane secretion effector (PF05977; HMM-score: 19.9)
    MFS_4; Uncharacterised MFS-type transporter YbfB (PF06779; HMM-score: 19.2)
    OATP; Organic Anion Transporter Polypeptide (OATP) family (PF03137; HMM-score: 9.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 12
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 63
    • Cmax: 0.144
    • Cmax_pos: 63
    • Smax: 0.16
    • Smax_pos: 3
    • Smean: 0.079
    • D: 0.099
  • predicted transmembrane helices (TMHMM): 12

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGTLADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADISPSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDPKKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDISIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANDYWSIMLISFVVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIYMAIGVSLAGVVIVLIEKQHRAKLKEQNM

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]