From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002579000
  • symbol?: norA
  • description?: multidrug efflux MFS transporter NorA

      descriptions from strain specific annotations:

    • multidrug efflux MFS transporter NorA
    • multi drug resistance protein (norA)
    • quinolone resistance protein
    • MFS transporter
    • quinolone resistance protein NorA
    • quinolone resistance norA protein
    • multi drug resistance protein
    • fluoroquinolone resistance protein
    • major facilitator superfamily multidrug/H(+) antiporter
    • major facilitator transporter
    • multidrug/H+ antiporter
    • multidrug resistance family protein
    • multidrug resistance protein 1 (Multidrug-efflux transporter 1)
    • multi drug resistance protein NorA
  • strand?: +
  • coordinates?: 3091018..3092248
  • synteny block?: BlockID0018150
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL0754 (norA)
    N315:
    SA0650 (norA)
    NCTC8325:
    Newman:
    NWMN_0664 (norA)
    USA300_FPR3757:
    04-02981:
    SA2981_0672 (norA)
    08BA02176:
    C248_0779 (norA)
    11819-97:
    MS7_0746
    71193:
    ST398NM01_0772
    ECT-R 2:
    ECTR2_646
    ED133:
    SAOV_0729
    ED98:
    SAAV_0657 (norA)
    HO 5096 0412:
    SAEMRSA15_06210 (norA)
    JH1:
    SaurJH1_0735
    JH9:
    SaurJH9_0719
    JKD6008:
    SAA6008_00711 (norA)
    JKD6159:
    SAA6159_00650 (norA)
    LGA251:
    SARLGA251_06280 (norA)
    M013:
    M013TW_0681
    MRSA252:
    SAR0748 (norA)
    MSHR1132:
    SAMSHR1132_06400
    MSSA476:
    SAS0660
    Mu3:
    SAHV_0692 (norA)
    Mu50:
    SAV0695 (norA)
    MW2:
    MW0657 (norA)
    RF122:
    SAB0644 (norA)
    ST398:
    SAPIG0772
    T0131:
    SAT0131_00765
    TCH60:
    HMPREF0772_12492 (norA)
    TW20:
    SATW20_07700 (norA)
    USA300_TCH1516:
    USA300HOU_0718 (norA)
    VC40:
    SAVC_03110

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGT
    N315            MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGT
    NCTC8325        MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGT
    Newman          MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGT
    USA300_FPR3757  MNKQIFVLYFNIFLIFLGIGLVIPVLPVYLKDLGLTGSDLGLLVAAFALSQMIISPFGGT
                    ************************************************************

    COL             LADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADIS
    N315            LADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADIS
    NCTC8325        LADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADIS
    Newman          LADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADIS
    USA300_FPR3757  LADKLGKKLIICIGLILFSVSEFMFAVGHNFSVLMLSRVIGGMSAGMVMPGVTGLIADIS
                    ************************************************************

    COL             PSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
    N315            PSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
    NCTC8325        PSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
    Newman          PSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
    USA300_FPR3757  PSHQKAKNFGYMSAIINSGFILGPGIGGFMAEVSHRMPFYFAGALGILAFIMSIVLIHDP
                    ************************************************************

    COL             KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDI
    N315            KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDI
    NCTC8325        KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDI
    Newman          KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDI
    USA300_FPR3757  KKSTTSGFQKLEPQLLTKINWKVFITPVILTLVLSFGLSAFETLYSLYTADKVNYSPKDI
                    ************************************************************

    COL             SIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANDYWSIMLISF
    N315            SIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANGYWSIMLISF
    NCTC8325        SIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANDYWSIMLISF
    Newman          SIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANDYWSIMLISF
    USA300_FPR3757  SIAITGGGIFGALFQIYFFDKFMKYFSELTFIAWSLLYSVVVLILLVFANDYWSIMLISF
                    **************************************************.*********

    COL             VVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
    N315            VVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
    NCTC8325        VVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
    Newman          VVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
    USA300_FPR3757  VVFIGFDMIRPAITNYFSNIAGERQGFAGGLNSTFTSMGNFIGPLIAGALFDVHIEAPIY
                    ************************************************************

    COL             MAIGVSLAGVVIVLIEKQHRAKLKEQNM
    N315            MAIGVSLAGVVIVLIEKQHRAKLKEQNM
    NCTC8325        MAIGVSLAGVVIVLIEKQHRAKLKEQNM
    Newman          MAIGVSLAGVVIVLIEKQHRAKLKEQNM
    USA300_FPR3757  MAIGVSLAGVVIVLIEKQHRAKLKEQNM
                    ****************************