From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0747 [new locus tag: NWMN_RS04225 ]
  • pan locus tag?: SAUPAN002712000
  • symbol: secG
  • pan gene symbol?: secG
  • synonym:
  • product: preprotein translocase subunit SecG

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0747 [new locus tag: NWMN_RS04225 ]
  • symbol: secG
  • product: preprotein translocase subunit SecG
  • replicon: chromosome
  • strand: +
  • coordinates: 840997..841230
  • length: 234
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGCATACATTTTTAATCGTATTATTAATCATTGATTGTATTGCATTAATAACTGTTGTA
    CTACTCCAAGAAGGTAAAAGCAGTGGACTTTCAGGTGCCATCAGTGGTGGTGCTGAGCAG
    TTATTCGGTAAACAAAAACAACGTGGCGTCGATTTATTCTTAAATAGATTAACAATTATT
    TTATCAATATTATTTTTTGTACTTATGATTTGCATAAGTTATCTTGGTATGTAA
    60
    120
    180
    234

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0747 [new locus tag: NWMN_RS04225 ]
  • symbol: SecG
  • description: preprotein translocase subunit SecG
  • length: 77
  • theoretical pI: 8.22953
  • theoretical MW: 8399.2
  • GRAVY: 1.17922

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateProtein and peptide secretion and traffickingpreprotein translocase, SecG subunit (TIGR00810; HMM-score: 82.4)
  • TheSEED:  
    Murein hydrolase regulation and cell death Protein translocase membrane subunit SecG 
  • PFAM:
    no clan definedSecG; Preprotein translocase SecG subunit (PF03840; HMM-score: 83.7)
    DUF3852; Protein of unknown function (DUF3852) (PF12963; HMM-score: 14.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.198
    • Ymax_pos: 34
    • Cmax: 0.152
    • Cmax_pos: 34
    • Smax: 0.336
    • Smax_pos: 22
    • Smean: 0.204
    • D: 0.2
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MHTFLIVLLIIDCIALITVVLLQEGKSSGLSGAISGGAEQLFGKQKQRGVDLFLNRLTIILSILFFVLMICISYLGM

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]