From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0995 [new locus tag: NWMN_RS05590 ]
  • pan locus tag?: SAUPAN001425000
  • symbol: NWMN_0995
  • pan gene symbol?:
  • synonym:
  • product: phage anti-repressor protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0995 [new locus tag: NWMN_RS05590 ]
  • symbol: NWMN_0995
  • product: phage anti-repressor protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1102614..1103402
  • length: 789
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGCAAGCATTACAAACATTTAATTTTAAAGAGCTACCAGTAAGAACAGTGGAAATTGAA
    AACGAACCTTATTTTGTAGGAAAAGATATTGCTGAAATTTTAGGATATGCAAGGGCAGAC
    AATGCCATCAGAAATCATGTTGATAGCGAGGACAAGCTGACGCACCAATTTAGTGCATCA
    GGTCAAAACAGAAATATGATCATTATCAATGAATCAGGATTATACAGTTTAATCTTTGAC
    GCTTCTAAACAAAGTAAAAACGAAAAAATCAGAGAAACCGCTCGAAAATTCAAACGATGG
    GTAACATCAGACGTCCTACCAGCCATTCGCAAACACGGTATCTACGCAACAGACAATGTA
    ATTGAACAAACATTAAAAGATCCAGACTACATTATTACAGTGTTGACTGAGTATAAGAAA
    GAAAAAGAGCAAAACTTACTTTTACAACAAGAAATCGGAGAACTAAAACCCAAAGCAGAC
    TATGTAGATGAAATCTTAAAGTCAACTGGCACATTAGCCACAACTCAAATCGCGGCAGAC
    TACGGTATATCAGCACAAAAGTTAAACAAACTACTACACGAAGCTAGACTACAACGAAAA
    GTAAATAAACAGTGGGTGCTTTACTCAGAACACATGGGCAAGAGTTACACAGAATCAGAC
    ACTATACCAATTGTACGCTCTGACGGTAGAGAAGACACAGTTTTACAAACTAGATGGACA
    CAAAAAGGTAGATTGAAAATACATGAAATCATGACTGAATTCGGTTATGAAGCTAACGTA
    ACTGCTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    789

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0995 [new locus tag: NWMN_RS05590 ]
  • symbol: NWMN_0995
  • description: phage anti-repressor protein
  • length: 262
  • theoretical pI: 7.18406
  • theoretical MW: 30139.9
  • GRAVY: -0.604962

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Phage antirepressor protein 
  • PFAM:
    no clan definedANT; Phage antirepressor protein KilAC domain (PF03374; HMM-score: 101.8)
    Bro-N; BRO family, N-terminal domain (PF02498; HMM-score: 96.3)
    P22_AR_N; P22_AR N-terminal domain (PF10547; HMM-score: 19.1)
    HTH (CL0123) HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.125
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 40
    • Smax: 0.203
    • Smax_pos: 2
    • Smean: 0.154
    • D: 0.136
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MQALQTFNFKELPVRTVEIENEPYFVGKDIAEILGYARADNAIRNHVDSEDKLTHQFSASGQNRNMIIINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNVIEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAADYGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTESDTIPIVRSDGREDTVLQTRWTQKGRLKIHEIMTEFGYEANVTA

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]